KEGG   Xenopus tropicalis (western clawed frog): 100216077Help
Entry
100216077         CDS       T01011                                 

Gene name
slc9a3r2, e3karp, nhe3rf2, nherf-2, nherf2, octs2, sip-1, sip1, tka-1
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 348 aa AA seqDB search
MAQERHRPRLCHIKRGEQGYGFHLHGEKGKSGQYIRKVEPGSPAEAAGLKAGDRVLEVNG
DNVEKETHHQVVQRIKAIENETRLLVVDRETDEYLKKSPPGSPTESQPNSSAPSTPTPGS
NNNGEVWKTKEDTSHEDQLHNNHSTENGKQDMNGQVKERCPRLCYLKKGPSGYGFNLHSE
KSRPGQFIRSVDPGSPAAKAGLRPQDRLVEVNGQNIENMKHSEVVANIKSKDNETKLLVI
DQETDDYFKKLGIAPTEAHGKGTIPLTNGVTPTQLNGDSSTSSSHSDLQSPDKDSQAGDL
IRKDPFEESGLRLSPTAAEAKEKAKAKRANKRAPQMDWSKKHEIFSNF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagagcggcaccgaccccggctgtgtcacatcaagaggggagagcagggctac
ggcttccacctgcacggcgagaagggcaagagcggccagtacatccgcaaggtggaaccc
ggctcccccgccgaggctgccggactgaaggctggagaccgggtgctggaagtcaacggg
gacaacgtggagaaagagacccatcaccaggtggttcagcgcattaaagcaatagaaaac
gaaacgcggttgctggtggtggacagagaaactgatgagtacctgaaaaaatccccaccc
ggctcacctactgaatcccaacccaactccagcgccccctcaactccgactccagggagc
aacaacaacggcgaagtatggaaaacaaaggaggacacaagccatgaagatcagctacac
aataaccacagcacggagaacgggaaacaggatatgaacgggcaagtgaaggagaggtgc
cctcgtctctgttatttgaaaaaaggccccagtggttatggctttaatctgcacagtgaa
aaatcccggccgggccagtttatcaggtctgtggacccaggatcaccggcagccaaggct
ggcctaagaccgcaggatcggctggtagaggtgaacggacagaatattgaaaacatgaag
cattcggaagtggtggccaacatcaaatccaaggacaatgaaacaaagttacttgttata
gaccaagagacggacgattacttcaagaagctcgggattgcccccactgaggctcatgga
aaaggcaccatccccttgaccaacggtgtgacccctacacagctgaatggagactcttca
acgtcttcatctcacagcgacctgcaaagcccggataaggactcacaggcaggtgacctg
atcaggaaggacccattcgaggaaagcggtctgcggctcagccctacagcagctgaagct
aaggagaaagcaaaggccaagcgagccaacaagcgcgctccacagatggactggagcaag
aagcacgagatcttcagcaacttctaa

DBGET integrated database retrieval system