KEGG   Xenopus tropicalis (western clawed frog): 100216099Help
Entry
100216099         CDS       T01011                                 

Gene name
prkaa2, ampk, ampk2, prkaa
Definition
protein kinase, AMP-activated, alpha 2 catalytic subunit (EC:2.7.11.1)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100216099 (prkaa2)
   04150 mTOR signaling pathway
    100216099 (prkaa2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100216099 (prkaa2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100216099 (prkaa2)
   04920 Adipocytokine signaling pathway
    100216099 (prkaa2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100216099 (prkaa2)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100216099 (prkaa2)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100216099 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    100216099 (prkaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 551 aa AA seqDB search
MAEKQKHDGRVKIGHYILGDTLGVGTFGKVKMGEHQLTGHKVAVKILNRQKIRNLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEAEARRLF
QQIISAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
AATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFIDESTLHIP
PGVKPHPERMPPLIADSPKARCPLDALNTTKPKPLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNPYHLRVRRKNPVTGTYVKMSLQLYQVDNRSYLLDFKSIDDEVMEQK
SGSSTPQRSCSAAGLHRPRLSIDSSTSDYSAPSGPLFGSFSGSFSLVNPRLGSHTMDFFE
MCASLITTLAR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgatggacgggttaaaataggacactacatcttgggtgac
acgctaggagttggcaccttcggaaaagtgaaaatgggtgaacatcagctaacagggcat
aaagttgcagtgaaaatattgaacagacaaaaaattcgtaatttggatgttgttggcaaa
ataaagagagaaatacaaaatctaaagctttttcgacaccctcacataataaaactgtac
caagtcattagcactccaacagattttttcatggtcatggaatacgtctctggaggagaa
ttgtttgactatatctgcaaacatggaagggttgaagaagcagaggcaagacgccttttt
caacagatcatttctgctgtagattactgtcacagacatatggtggttcaccgcgatctg
aaaccagagaatgtgctgcttgatgcacacatgaatgccaagatagctgattttggatta
tccaacatgatgtcagatggggaattcctgcggaccagttgtggttcacctaattatgca
gcaccggaagtcatatcgggaagattgtatgcaggtcctgaggttgatatctggagctgt
ggagtgatactctatgctcttctctgtggaactctaccatttgatgatgaacatgttcca
actctttttaagaagataagaggaggagtattttacatccctgagtacctaaaccgctct
gctgctacattgttaatgcatatgcttcaggttgaccctcttaagcgtgccactatcaaa
gacataagagaacatgaatggtttaaacaggatttacccagttacttgtttccagaagac
ccgtcatatgatgccaatgtaattgatgatgaggctgtgaaggaggtgtgtgagaagttt
gaatgtacagaatccgaagttatgaacagtttatacagcggtgacccacaagaccagctt
gctgttgcctaccatcttataatagacaatcgaagaataatgaaccaggccagtgaattc
tacctcgcctctagtccaccaactggctcattcatagacgaaagcactttgcacatccca
cctggagtgaagccacacccagaaagaatgccacctctaatagcagatagtccaaaggca
agatgccctttagatgctttgaacaccaccaaacctaaacccctagctgtgaaaaaagcc
aagtggcacttggggatccgcagccaaagtaaaccatatgatattatggctgaagtttat
cgagctatgaagcaacttgattttgaatggaaggtagttaacccttatcatctccgtgtg
agaagaaagaatccagtgactggtacttatgtgaaaatgagtctgcagctctaccaggtt
gataatcgcagttaccttttggacttcaaaagtattgacgatgaagtcatggaacaaaaa
tcaggttcttcaacccctcaacgttcttgctctgcagctggcctgcacagaccacgcctg
agtattgactcgagcacatcagactattcagcgccaagtggacctctgtttggctctttc
tcaggcagttttagtttagttaaccctcgcttggggagccataccatggatttctttgaa
atgtgtgccagtctgattacaacgctggctcgttaa

DBGET integrated database retrieval system