KEGG   Xenopus tropicalis (western clawed frog): 100216158Help
Entry
100216158         CDS       T01011                                 

Gene name
abhd12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100216158 (abhd12)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100216158 (abhd12)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100216158 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
5
AA seq 386 aa AA seqDB search
MRKRAEPVPPEHESFGRAPLDRECSIKQKLRIPGTKGHYPHDSDCDSKGMKRFGRRYGLW
SRLRMFLIFLLGLYIAIPFLVKICPAIQTQLVFLNLVRFPYFIDLKRPEDQGLNHTCNFY
LQPEEDVSIGVWHTVPAVLWKDAQGKDLEWYEEVLSTSYPVILYLHGNAGTRGGDHRVQL
YKVLSSMGYHVISFDYRGWGDSVGSPSESGMTYDALHVFDWIKARSGDNPVYIWGHSLGT
GVATNLVRRLCERETPPDSLILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITASG
IKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYNIAAPARSLRDYKVQFVPFHKDLG
YRHKYIYRSPELRQILRDFLGNTEQQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagagagccgagccggtgcccccggaacatgagagcttcggcagggccccactg
gacagggagtgcagtataaagcagaaactgagaatccctgggacaaaggggcattatcca
cacgattccgactgcgacagcaagggcatgaagaggttcggcaggcgttatggtttgtgg
tcccggctccgaatgtttctaatctttctacttggattgtatatagctattccattcctt
gtaaagatctgccctgctattcaaactcagctggtgtttttaaatttagtaaggtttcca
tattttattgacttgaagaggcctgaggatcaaggcttaaatcacacttgcaatttttac
ttacagccagaggaggatgtgtctattggagtttggcacaccgttcctgcagttttatgg
aaagacgctcaggggaaagacctagagtggtatgaggaggttttgtctacaagttaccct
gtgatcctctacttgcacggaaatgcaggcacacgaggaggtgatcacagagtgcagctt
tataaggtgctcagttccatgggttaccacgtcatttcatttgactacagaggatgggga
gattctgtaggttctccatcagagagcggcatgacctatgatgctctgcacgtttttgat
tggataaaggcacggagcggagacaatccagtttacatatgggggcactcattaggcaca
ggggttgcaaccaatctagtaagaagactttgtgaaagagaaacccctccggattccctg
atcctggaatctccatttaccaatattcgggaggaggcaaagagtcatccattttctgtg
atatatagatacttcccgggttttgactggtttttcttagaccccatcacagcaagtggc
attaagtttgccaacgatgacaatgtgaaatatatttcctgtcccctgctcattttacac
gcagaagatgatcctgttattccatttcatcttggaaaaaagctttacaacattgcagcc
ccggcacgaagtttacgtgattacaaagtccagtttgttccattccataaagatctggga
tacaggcacaaatacatctaccgtagtccagagttgcgccagatactgagggatttcctg
ggaaacacagagcaacaataa

DBGET integrated database retrieval system