KEGG   Xenopus tropicalis (western clawed frog): 100216266Help
Entry
100216266         CDS       T01011                                 

Gene name
pfkm, pfk
Definition
phosphofructokinase, muscle
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100216266 (pfkm)
   01230 Biosynthesis of amino acids
    100216266 (pfkm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100216266 (pfkm)
   00030 Pentose phosphate pathway
    100216266 (pfkm)
   00051 Fructose and mannose metabolism
    100216266 (pfkm)
   00052 Galactose metabolism
    100216266 (pfkm)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100216266 (pfkm)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100216266 (pfkm)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100216266 (pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 841 aa AA seqDB search
MSATDDFDRILIKLLITVSISAGLFIFFAVFQLKKKKPSFSDFDEVETRPDPIYNQTDKT
MLASRSKHHDAQTMGTGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGL
VDGGDNIKEATWESVSMMLQLGGTVIGSARCQDFRGREGRLKAACNLVKKGITNLCVIGG
DGSLTGADTFRTEWSNLLADLVKAGRITADESKKSSHLNIVGLVGSIDNDFCGTDMTIGT
DSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITALACGADWVFIPESPPEEN
WEEHLCRRLSETRGRGSRLNIIIVAEGAIDLNGKPITSDLVKDLVVKRLGYDTRVTVLGH
VQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAIRLPLMECVQVTKDV
TQAMTEKRFDEALKLRGRSFENNWKVYRTLAHVRPTATKSGYNLAILNVGAPAAGMNAAV
RSTVRIGIIQGHTMFAVHDGFEGLAKGQLEEIGWSGVGGWTGQGGSRLGTKRTLPKKYFE
DISNTISNYNIHGLIIIGGFEAFTGSLELMEGRCKYEELCIPIVVIPATVSNNVPGSDFS
IGADTALNTITVTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGFAAGADAAYIYEEQ
FSIHDLQINVEHLTEKMKTTVKRGLILRNERCNDNYSTDFIFNLYSEEGKGVFDCRKNVL
GHMQQGGTPTPFDRNFGTKMGAKAVLWMTGKVKECSRHGRIFANTPDSACLLGMRKRSLV
FQPLVELKEQTDFEHRLPKEQWWLKLRPILKILAKYNISLDTSEHAHMEHITRKTSPPAH
I
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccactgatgactttgataggattctgatcaaactgctcattacagtctctatc
tcagccggactcttcattttctttgctgtttttcagctgaaaaagaaaaagcccagtttt
agcgactttgacgaagtggaaacaaggcctgatcccatatacaatcagactgataaaaca
atgctggcctcaagatcgaaacatcatgatgcccaaactatgggcactggaaaagcaatt
gctgtactgacatccggaggcgatgcacaaggaatgaatgcagctgtcagagccgtggta
agagtgggaatatatacaggcgccaaagtctactttgtccatgagggataccagggattg
gttgacggaggtgacaacatcaaagaagctacatgggaaagtgtttcaatgatgctgcag
ttgggtgggacagttataggcagtgcaagatgtcaagatttccgaggccgagagggtcgc
cttaaagcagcctgcaatctggttaagaaaggaattaccaacttgtgtgtgattggtgga
gatggcagcttgactggagcagacacctttcgaacagagtggagcaacttgctggctgat
ttagtaaaagcaggtagaattactgctgacgaatccaaaaagtctagtcatctgaatatt
gttgggttagttggatccattgataatgatttctgtggcactgatatgacaatcggtaca
gactctgccttacacagaataatggaaatagtagatgccatcacaaccactgcacaaagt
caccagaggacctttgttcttgaagtgatgggtcgacactgtgggtatttggccttgata
acggctcttgcctgtggtgctgattgggttttcattccagaatcaccgcctgaagagaac
tgggaagaacatctttgtagaaggttaagtgagacaagaggacgtggatcacggctgaac
attatcatcgttgctgaaggcgcaattgatctgaatggcaaacccattacatccgatcta
gttaaagatttagtggtaaaacgtctgggatatgacacaagggtcactgtgcttggacat
gttcagcgaggtggaacaccatccgccttcgacagaattttgggaagccgaatgggtgtt
gaagctgtgatggccctgttggaaggaacaccagatacaccagcttgtgtggtcagtttg
tctggaaatcaagcaattagacttccactgatggaatgtgtacaagtgactaaggacgtg
acacaggcgatgactgagaagaggtttgatgaggcccttaaattacgaggaaggagtttt
gaaaacaactggaaggtttatagaaccttggctcatgtcagacctacagctacaaagagt
gggtataatctggctattctgaatgttggagcacccgcagcaggcatgaatgcagcagtg
aggtccacagtgagaattggcattattcaaggtcacacaatgtttgctgttcatgatgga
tttgaggggcttgcaaaaggacagcttgaagaaattggatggagcggtgttggtggatgg
actggacaaggaggatcacgtcttggcactaagaggactctgcccaagaaatactttgaa
gacatcagtaataccataagcaactataatatacatgggctgatcattataggcggtttt
gaggcatttacaggcagcttggaactgatggaagggcgttgcaagtatgaagaactatgc
atacccattgttgttatccccgccactgtgtcaaacaatgttcctggatctgatttcagt
attggtgcagatacggctcttaacacaattacagttacctgcgatcgaatcaagcagtct
gccgcaggcactaagcgaagagtctttatcattgagacaatgggaggttactgtggttat
ctggctacaatggcaggatttgctgccggtgctgacgcagcttatatttatgaagaacaa
ttcagcatacatgatttacaaattaatgttgagcaccttacagaaaaaatgaagaccaca
gtaaaacgaggtttaatactgaggaatgagaggtgcaatgacaattattcaacagatttt
atatttaatttgtattctgaagaaggaaaaggtgtttttgactgcaggaagaatgtcctt
ggtcacatgcagcagggcggaacccctactccctttgatcgaaactttggcacaaaaatg
ggtgcaaaggccgtcctttggatgacagggaaagtgaaggaatgctctagacatggccgc
attttcgctaacacaccagactcggcttgtttgctgggaatgcgcaagcgaagtcttgtt
ttccagcctctggttgaactgaaggagcagactgattttgaacatcgtctccccaaagag
cagtggtggctgaaactccgccccatcctgaaaattctcgcaaaatataatatcagcctg
gacacatctgaacacgcacatatggaacacattacccgcaagacatctcctccagcccat
atctag

DBGET integrated database retrieval system