KEGG   Xenopus tropicalis (western clawed frog): 100329116Help
Entry
100329116         CDS       T01011                                 

Gene name
flnc
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xtr05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 2723 aa AA seqDB search
MSSNDYYDQQQFYQGEEAEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKRIGDL
QKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLDREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDEEDAKKQTPKQRLLGWIQNKIPQLPITN
FHRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFTV
ETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNIN
KSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNH
QDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRAT
GRGLQPKGVRVKEVADFKVFTKGXGSGELKVTVKGPKGTEEPVKIRDAGDGVYECDYYPV
LPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILP
ASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKD
NGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGK
YTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKA
KLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNV
APPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVT
SDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKP
APFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHI
PGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKA
EVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGV
EPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYE
DGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEI
VDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGT
HTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDE
IPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTC
KVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVACDTIPI
IEEPCDTVQLHQPYPAHLPGYPTNWATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGE
VRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRH
VSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPT
APGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASI
RAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDA
SKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYC
PTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRMKESITRRRQAPSIASIGSTCDLNLKIP
GNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFHNV
FGEFLGRESLGTFGSITRQEGEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQE
MGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREA
GAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVA
SRSDDARRLTVTSLQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSD
KYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGR
PSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQH
IVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRG
PGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKG
DYILIVKWGDQNVPGSPFQVAVP
NT seq 8172 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacgattattacgaccagcagcagttttaccagggcgaagaggcagaggag
atgcccgctacagagaaggacttggcagaagatgccccttggaagaagatccagcagaac
accttcaccaggtggtgtaatgagcatctcaagtgcatgaacaagcgcattggggacctg
cagaaggacctgagtgatggcctgaagctcataggcctgctggaggtgctcagtcagaag
aagatgtacagaaagtaccattccagacccaactttcggcagatgaaactggagaacgtg
tcagtggctctggaattcctggatcgggagcacatcaagctggtgtctatagattcaaaa
gccattgtagatgggaacctaaagctgatcctgggtctaatctggacacttatccttcac
tactccatttctatgcccatgtgggaggatgaggatgaagaagatgcaaagaagcagact
ccaaagcagagacttctgggatggatacaaaacaaaataccacagcttccaatcaccaat
ttccaccgtgactggcaggatggcaaagctttgggagctcttgtggacaattgtgcccca
ggtctgtgtccagactgggaggcctgggatcccaaccagcctgtggagaatgcaagagag
gccatgcaacaagcagatgattggttgggagtaccacaggtcattgccccagaggagatt
gtagatcccaacgtggatgaacattcagttatgacttacctgtcacagtttcctaaagcc
aaattgaaaccaggagcaccactccgatccaagcagttacaccccaagaaagcaaatgcc
tatggaccaggtattgagcctcatggaaacatggttctgaaacctgcctacttcacagta
gagaccataaatgctggtctgggggaagtattagtgtttgtggaagatcctgaaggacac
acagaagaggccaaagttattcctaacaatgacaagaacagaacctactcagtaagctat
gttccaaaggttgccggccttcataaggtcactgtgttgtttgctggccagaatatcaac
aaaagtccattcaacgtcaatgttgccatggcattgggagatgctaataaggtgacagca
cgaggacctggactggagcctgttggaaatgttgccaataaaccaacatattttgatatc
tacactgcaggtgctgggtctggtgatgttggtgtaatcattgtagacccacagaaccat
caagatacagtggaagtcattttagaagacaaaggggacaatatatatcgctgcacttat
cgtcccaacatggagggaccccacaaagtcttcattacttttgctgggtctcaaatcccc
aaatgcccatatgttgtcaatatctcagaagcatgtaatcccaatgcctgcagagccaca
ggccggggcttacagcccaaaggtgtgcgtgtgaaggaagtggctgatttcaaagtattc
accaaaggangcggaagtggagaacttaaagtcactgttaaagggccaaagggtacagag
gagccagttaaaatccgcgatgcaggggatggtgtatacgaatgtgattattacccagtg
ttgccaggaaaatatacagtgactatcacatggggtggatatgccatccccaggagcccc
tttgaagtccaagttagcccagaagtgggattacagaaagtgagagcatggggtcctggc
ctagagactggcatggttggtaaatcagctgactttgtagtggaagcaataggcacagaa
gttggaactcttggcttctccattgagggcccatcccaggcaaagattgagtgtgatgac
aagggtgatggatcttgtgatgtacgctattggcccacagaacccggcgagtatgcagtt
catgtaatttgtgatgatgaagatataaaagacagccctttcattgctcatatcctgcca
gctagcaacaaaggattccctgagaaggttaaagcatatggacaaggtttagaacccaca
ggctgcatagtagagcatcctgctgagtttactattgatgctcgggctgctggcacggct
gaactgaaaatatatgctcaggatgcagaggggtcaccaattgacatcaagatcaaggac
aatggtgacaacacctatgtgtgtgtctatgtaccaaccaagccaatcaagcacacaatc
attattacatggggaggagtcaatattccaaacagcccgtatagggtgtcagtcggagag
ggcagtcatcccaataaagtaaaggtttatggacctggcgtagagaagacaggactaaaa
gccaatgagccaacatattttacagtggactgcagtgaagctggacaaggagatgtcagc
attgggattaagtgtgctcctggagttgtgggaccagcagaagcagatattgactttgac
attatcaagaatgacaacgatacatttactgtaaaatacacaccccctggagcagggaaa
tatactatcatggtgttgtttgctgaccaggaaatacctaccagtccattccgagtcaag
gtagatccctcacatgatgctagcaaagtccgtgcagaaggcccagggcttaaccgtaca
ggagtggaggttggaaaacccacacattttactgtttacaccaagggagctggtaaggct
aaacttgatgttcagtttgctgggagcattaagggtgaagctgtgcaagactttgaaatc
attgataaccatgactattcatacactgtgaagtatacagcagtgcagcagggtacctta
actgtgtcagtaacttatggaggggaccccattcctaaaagtcctttcaatgttaatgtg
gcacctcctctagatttgagcaaagtcaaggttcaagggcttaacaacaaggtagatgtc
gggaaagaccaggagttctcaattgataccagtggagctggaggtcaaggaaaagtggat
gtgaagatcacatctccttctcgtcggccaataccctgtaaagtagagactggagttaca
agtgacattcacacggtgaaatacatgccccctgaggagggcccatataaagtggacatc
agctatgatggacatcctgtaccaggaagccccttctctgtggaggcagtaatgccacct
gactcttccaaggttcgtgcctatggacccggattgaaaggaggttttgtaggaaaacca
gccccatttgcaattgacaccaaaggagctggtacaggaggattgggtcttacagtagaa
ggtccatgtgaggcaaaaattgaatgccaggataatggagatggctcctgctcagtttct
taccttcccactgaaccaggggaatattctataaacatcctatttgcagaatcccacata
ccaggctctccattcaaggctgacatccgccctgtctttgaccccagcaaggtcacagct
agtgggcctgggcttgaaaaaggaaaagctggtgaagtggccaccttcaccgtggattgc
tccaaagctggggatgcagagcttacaattgagatcctgtcagattcaggttcaaaggct
gaagtactgattcagaataacagcgatgggacctacagcatcacctacattccagcatgc
cctggagcctacacaattaccatcaagtatggaggtcacgctgtcccaaaattccctgtg
cgtgtaaatgtagagcctgcagtagacaccagtggcgtgaaggtgtttggcccaggggtg
gaacccagaggggtgcttcgtgaggtaactacagaattcaccgttgatgctcgttccctc
actaagactggtggcagtcacgtgaccacgcgcattctcggcccctctggagctgtcact
gagagtttcttatcagacaatggagatggcacctaccatgtgcagtatacagcgtatgag
gatggagtgcacttgattgaagttctttatgatgatgttccagtgccaaagagcccattt
cgtgtgcctgtgactgagggctgtgatccatctcgtgtacgggcatatggtccagggctt
gaaggagggctgcttaacaagtctaaccgttttactgtggagacaaggggagctggaact
ggggggcttggtctggccatagaaggtccttctgaggcaaaaatgtcatgtaaggataat
aaagatggaagttgcagtgtggaatacataccatttactccaggagattatgatgtgaat
atcacatttggggggcgtcccattccaggaagtcccttccgtgttccagttaaggaaatt
gtggaccccagcaaggtgaagtgttctggtcctgggcttggatctggtgtcagagcccat
gttcctcagactttcacagtggattgtagtaaagctggactggcaccactagaagtgctg
gtgcaaggaccctcaggtttggcagagcctgtagatataagagataatggagatgggaca
cacacagttaattatactccagccacagatggaccatacactgtgtctgtaagatatgct
gatcaggaggtgccacgaagcccattcaagatcaaagtgctgccaacccatgatgccagc
aaagtgcgcgccagtggccctggtctcaacacagcaggtattccagccagcctgcctgtt
gagtttaccattgatgcccgtgatgcaggggaaggtctgctaactgttcagattctggac
cctgaaggtaaaccaaagaaggcaaatattagaggcaatggtgatggcacctacacagtg
tcttatgtaccagacatggctggaagatacactatcaccatcaaatatggaggagatgaa
attccttactcacctttccgaattcatgctgtgcccactggtgatgccagcaagtgctta
gtgacagtgtctattggtggacatggattaggaacatgcctgggaccctcaattcagatt
ggggaggagactgtcatcacagtggatgctaaagctgcagggaaaggcaaggtgacctgc
aaagtatcaacacctgatggagcagaactggatgttgatgtagtggaaaatcaggatgga
acttttgacatttactacacagctcctgagcctggcaaatatgtaatcacaattcgtttt
ggtggcgagcacatacccaacagccccttccatgttgtggcatgtgacaccattcccatc
atagaggaaccgtgtgatacagtacaactacaccagccctaccccgcacacctccctggc
tatccaactaactgggccacagaggagccagtagttcctgtagagaatttggataccatg
ctgaggccattcaatttagtcattccctttactgtgcaaaaaggggaaattacaggtgaa
gtacgtatgccttctggtaagacagctcgtcctaatattacggataacaaagatggcact
gtcactgtgaaatttgcacctgttgaaaaaggactacatgagatggacataaaatatgat
ggaaaccatattccagggagcccactgcagttttatgtagatgccattaatagcagacat
gtaagtgcatatgggccaggactgagtcatggaatggtgaataaaccagcaacgtttact
attgttacaaaggatgccggtgaaggtggattatccctagcagtggaaggaccatcaaaa
gctgagatcacttgcaaagacaataaagatggcacttgcaccgtatcctacatgccaaca
gcccctggtgattataacatcattgtgagatttgatgataagcacatccctggtagcccc
ttcacatccaaaataacaggtgatgactcaatgagaacttcccagctgaatgtgggaacc
tccacagatgtttccctcaagattacagaatcagacttgagtttgcttactgctagtatc
agagctccatctggaaatgaggagccgtgtctactaaagaggcttcccaacaggcacatt
ggcatttcatttacaccaaaagaagttggtgagcacgtagtaagtgttaagaagaatggg
aagcacgtcactaatagcccattcaaaatcatggtgggaccatctgaaattggagatgcc
agcaaggtgaaagtgtctggaaagggactgctggagggagtaacatttgaagtggctgaa
ttcattgtagacaccaggaatgcaggatatggaggattgggcttatccattgaaggccca
agtaaggtggatattaattgcgaagatatggaagatggaacatgtaaagtgtcttactgt
cctactgagcctggaacatacattataaacattaagtttgcagaaaagcatgtgccagga
agtccatttatggtaaaagtgacaggtgagggacgtatgaaggagagcataacccgaagg
cgtcaggctccttctattgcgagcattggcagcacctgcgatctcaacttgaagatacca
ggcaattggttccagatggtatcagctcaagaacgtttaactcgcacctttacacgtagc
agccacacatacactcgtacagagcgcacagagatcagtaagacccgaggaggtgagaca
aagcgcgaagtgcgtgtggaggaatctacacaggttggcggtgatcctttccataatgtg
tttggagagtttctgggtcgggaaagcctaggaacatttggcagcatcacaaggcaggaa
ggagaggctggtgcccaggaaatgacagcccaagtaacaagcccctctggacaaacagca
gacgctgaaataattgatggtgaagataacacatacagtgtgcgttttgtgccacaggag
atgggtgctcacacagttagcgtcaagtaccgtggccagcatgttcctggtagtcccttc
cagttcactgttgggcctatgggagagggaggcgcccataaagtcagggctggaggcccc
ggcctggaaagaggagttgcaggtgtaccagctgaattcagcatctggacacgagaggca
ggagctggaggtctatcaatagcagtagaaggtccaagcaaagcagagatcacttttgaa
gatcgaaaggatggatcctgtggagtgtcttacattgtacaagaagcaggtgattatgag
gtttccatcaaatttaatgatgagcacattccagacagcccctttgtagtacctgtggct
tcccgttctgatgatgcccggagactgacagtcaccagcctacaggagactggaataatt
gttaatcaaccagcttcatttgctgtacaactgaatggagcccgtggagtgatagatgcc
aaggttcacaccccatcaggaatggttgaggagtgttatgtatcagaagttgatagtgat
aagtactcaatccgtttcattccacgggaaaatggtgtgcactccattgatgttaaattt
aatgggcgccacataccaggcagtcccttcaagattcgtgtgggagaacaaagtcaagca
ggcgaccctggtcttgttacagcttatgggcttggactggagggtggagtcacaggtaga
ccctctgagttcattgtaagtactctaaatgctggagctggatccctctctgttactatt
gatggaccttctaaagtgaaactagactgtcaggattcccctgagggatataaagtctca
tacacaccaatggcccctggaaactacttgatttccatcaaatatggaggcccacaacac
attgtaggaagtccatttaaggccagagtgacaggtgtacgtctgtcaggtggtcacagc
cttcatgaaacctccacagtgttggtggaaactgtcaccaaatcctctgcatctgttgga
ggatatgcaatgacagcacctaaattctcatcagatgcttccaaagtggtatcccgtgga
cctggcctgtctaaagcctttgtgggacagaaaaacacattcactgtggactgcagcaaa
gctggcaccaacatgctaatggtaggagtgcatgggccaaagaccccctgtgaggaggtg
tatgtaaagcacatgggaaaccgactgtacaatgtgacctacactgttaaagataaaggg
gactacatcttgatcgtcaagtggggtgaccagaatgtccctgggagtccatttcaagtt
gctgtcccttga

DBGET integrated database retrieval system