KEGG   Xenopus tropicalis (western clawed frog): 100379714Help
Entry
100379714         CDS       T01011                                 

Gene name
mgam
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xtr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xtr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1810 aa AA seqDB search
MGKKRKFSSLEIILIVLFIIMAIIAVVLVALFATGQSGVRNSSGDPPFEPQCPNIDFIDH
RIDCIPEDVASQEICIQRGCCWSPHDVINVPWCYFTNAHGYEVKGKKNTQAGFEANLQRL
PAPAIYENNIEQLLLAAEMQSNNRFRFKITDPKSKRFEVPHEHIKEFTGSAASNLNYDYK
LLDKPFGIQVIRKSNSRILFDSTIGPLLYADQVLQLSIKLPSSNIYGLGEHVHRQYKHDT
YWKKWAIFTRDEFPNGDGNNLYGAHTFFLCLEDTDGSSFGVFLMNSNAMEVTIQPAPAIT
YRTIGGILDFYVFVGNSPEQVVMEYLELIGRPYMPAYWTLGFHLSRWGYSSLDEVKQVVE
RNRAIGIPYDVQFTDIDYMEEKKDFTYDKVKFKDLPSFAEDLHAHGQRYIIILDPAIANT
PLIDGPYLAYERGTNLGVWVNESDGVTPLVGKVWPGDTVYPDYTNEACTKWWVQECLEFY
KQVPYDGIWIDMNEVSNFVRGSNKGCASNKLNYPPYTPRIKDNVMYSKTLCMDAKQAWGL
HYDVHNLYGYSMALSTEEAIKAVFPGKRSIIFSRSTFAGAGKYSGHWLGDNAANWNDIKW
AIPGMFEFSLFGIPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAETFKHQDPAS
YGADSLLVKTSRHYLNIRYTLLPYLYTLFYKAHTKGETVVRPLLHEFYSDPETWGIDNQF
LWGPGLLITPILNPNSVNAYVYIPDAKWYNYETGTQASWRKQNVDMYIPEDKIGLHVRGG
YIFPTQQPANTTFYSRKNPLGLIIALDDNQAARGDFFWDDGESRGTIESGTHILYEFSVS
NNILDMVVTHAKYTDPDNLKFEEIKIYGVQKSVSEVTVKKGGIVQPSGHTVRYDSNKVLV
ITGLQLVLGESYTVEWNQIEKNFEKYDCHPEPDAYEAKCQSRGCIWEPSDVPKEPWCYFP
SNYGYRVGNVQSTSTGIKMEITKGSMVVSPFGDLSPPISPINVDVIYHENNMLQFKIYDP
NNKRYEVPVPLNLPNSPTSTEAQRLYEVTVTDNPFGLQIRRKSSGAIIWNSQAPGFTFSD
QFIQISTILPSGYIYGLGETEHRTYRHDLNWVTWGMFAKDQPPGYTINAYGVHPFYLGLE
NDGNAHGVFLHNSNAMDVTLQPTPALTYRTVGGILDFYVVTGPTPEMVVQQYTALIGRPL
LPAYWSLGFQLCRYGYQNDKDIEDLYNEMVAAQIPYDVQYADIDYMERQMDFTLSQNFSG
LPSLVDKMRSDGMKIIIILDPAIAVNETKDYPPFRRGIEKDVFIKWADGRGIALGKVWPD
LPGVIVDQSLDWDTQVAIYRAHAAFPDFFKNETSEWWLQEIKDFYQNVLKFDGIWIDMNE
PASFVHGSVDGCTDALLNKPPYMPHLESRNAGLNHKTLCMETQQTLPDGTLVRHYDVHSL
YGWSHAKPTYDALTSVTGERGIVVSRSTYPSAGQWVGHWLGDNTAAWNQIDKSVIGMMEF
NLFGIPYIGADICGFFQDTTYELCARWMELGAFYPYARNHNGKGFMRQDPVSFDENFKTL
SKNVLNIRYKLLPYLYTLMFEAHTEGSTVIRPLLHEFTADKTTWDIYKQFLWGPAFMISP
ALEINQLVVKAYIPNTRWYNYHTGIQINERGTWVDLNTPLEHINLHIRGGYIIPWQEPAN
NTFYSRQKFMGVIVALDDQGQAKGNLFWDDGKSIDSVEKGQYLLTNFTADKNTVRNQILH
NNYVTAANPLHLGHVYIWGAGKNPVRSVTVTYGGTTETISSFTFQNEVLEIHLVNKRYNL
AEQIEVAWQI
NT seq 5433 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaagcggaagtttagttctctggaaattatcctcattgtgctattcattatc
atggcaatcattgcagttgtgcttgttgcactgtttgctacaggacaatctggtgtcaga
aatagttcaggggatcctccatttgagccccaatgtccaaacatagatttcatagatcac
aggatagactgtattccagaagatgtcgcttctcaggaaatttgcatacaacgaggttgc
tgttggagtcctcatgacgtaattaatgttccatggtgctattttacaaatgctcatgga
tatgaagtgaagggaaaaaaaaatactcaagcaggatttgaagctaacctccaaaggctg
cccgctcctgcaatttatgaaaacaacattgaacaattactcctagcagcagaaatgcaa
tccaataatcgctttagattcaagattactgacccaaaaagcaaacgatttgaagttccc
catgaacatataaaagagtttacaggttcagctgcatcaaatttaaattatgactacaag
ctgttggacaaaccttttggaatccaagtgataagaaaatcaaattccagaattctgttt
gattctacgattgggccacttctgtatgctgaccaagttttacagctctccattaaatta
ccaagttctaacatctatggcttgggggaacatgttcacagacaatataaacatgatacc
tattggaagaaatgggctatatttacaagagatgagtttcccaatggtgatggaaataac
ttatatggtgcacatacattttttttgtgtttggaagatacagatggatcttcttttgga
gttttcttaatgaacagcaatgctatggaagtaacaattcagcctgcaccagccattaca
taccgaactattggaggtatcctcgatttctacgtctttgtaggcaacagtccagagcaa
gtagtaatggaatacttagagcttattggaagaccttacatgcctgcatattggacactt
ggctttcatttgagtcgctggggctactcatctcttgatgaagtaaaacaagtggtggaa
agaaacagagccattggaataccatatgatgttcagtttactgacattgattatatggaa
gaaaagaaagattttacatacgacaaggtcaagtttaaggatcttccctcatttgccgaa
gatttgcatgcccatgggcagagatacatcatcatactggatcctgctattgccaatact
ccacttattgatggaccttatttagcctatgagcgaggaactaatctaggtgtgtgggtt
aatgagtcagatggagtaacaccacttgttggaaaagtttggcctggagatacagtatat
cctgattatactaatgaggcctgcacaaaatggtgggtgcaagaatgtcttgaattctac
aaacaggtgccatatgatggaatttggattgatatgaatgaagtgtctaactttgtgaga
ggctcaaacaaaggatgtgctagtaataagctaaactatcctccatacacaccaagaatt
aaggataacgtgatgtattccaagactttatgcatggacgcaaaacaggcctggggatta
cattatgatgttcacaacttatatggatattcaatggctttatctactgaagaagccatc
aaagctgttttccctggaaaaagaagcatcattttttctcggtcgacttttgctggagca
ggcaaatactcaggacattggcttggagataatgctgccaactggaatgatattaaatgg
gctataccaggaatgtttgagttcagcctttttggaataccttatattggtgcagacata
tgtggattttttgatgactcttcagaagaactgtgcagaaggtggatgcaagttggtgct
ttttatccattctcaagaaatcacaatgctgagactttcaagcaccaggatcctgcttct
tatggagctgattcacttttagtgaaaacatcaagacactacttaaacattcgctatact
ctgctgccatatctttacaccctattctacaaggctcacaccaaaggggaaactgtagtg
aggccattacttcatgagttctattctgatcctgaaacttggggaatagataaccagttt
ttgtggggtcctggacttctcattacacctatacttaatccgaactctgttaatgcttat
gtatatatccctgacgcaaagtggtacaactatgaaactggcactcaagcctcttggaga
aagcaaaacgttgacatgtacatcccagaagacaaaattggacttcatgtcagaggggga
tacatatttccaactcagcaaccagctaatactacattctatagccgtaaaaatccactt
ggccttattattgctttggatgataaccaggctgctaggggagacttcttctgggatgat
ggagaatccagagggacgatagaatcagggacccatattttatatgaattttctgtttca
aataatatattagacatggtggtcacccatgcaaagtatacagacccagataatctcaaa
tttgaagaaattaagatatatggagttcagaaatctgtcagtgaagtaacagtgaagaaa
ggcggcattgtccaaccctctggtcatacagttagatatgattctaacaaggttttagta
ataacaggtcttcagctggtattaggtgaaagttacactgtcgaatggaatcaaattgaa
aagaactttgagaaatacgattgccatcctgaacccgatgcctatgaggctaaatgtcaa
agcaggggatgtatctgggagccttcggatgtacccaaagagccatggtgttactttcct
agtaactatggttacagagtaggcaatgtgcagtcaacctctactggtataaaaatggaa
attaccaaaggttccatggttgtgtcacctttcggtgatctttcacctcccataagccca
attaatgttgatgtaatatatcacgaaaataacatgctacaattcaagatctatgacccc
aataataaaaggtatgaagtccctgtaccgctaaatctacctaacagtcctacaagtaca
gaagcacaacgcctttatgaggttactgttactgacaatccatttggccttcagatcaga
cgaaaaagcagtggagcaataatttggaactctcaagcacctggattcaccttctcagat
cagtttatccaaatttcaacaatacttccctctggatatatttatggtcttggagaaaca
gaacacagaacatatcgtcatgacttgaattgggttacttggggaatgtttgccaaagat
caaccccctgggtatactataaacgcatatggcgtgcatcccttttacttaggcctggaa
aatgatggcaatgctcatggcgttttcctgcataacagcaatgcaatggatgtaaccctg
cagccaactccagcacttacttatcgcacagtaggaggaattctggacttttatgtagta
acgggtccaactcctgagatggttgttcagcagtatacagcacttattggacggcctctt
ttgccagcatattggtctctgggatttcagttatgccgttatggataccaaaatgacaaa
gacattgaagatctctataatgaaatggtagcagctcagattccctatgatgtgcaatat
gccgatattgactacatggaaagacaaatggatttcactttaagccagaatttttcaggg
cttccttcattagttgacaaaatgagatcagatggaatgaaaatcatcattattttggat
ccagctattgcagtaaatgaaacaaaagattacccacctttcagaagaggaattgaaaaa
gatgttttcattaaatgggcagatggaaggggaattgcattgggaaaggtctggccagat
ttgcctggtgtcatagttgatcagtcacttgattgggatacacaagttgcaatttacaga
gctcatgcagcatttccagactttttcaagaacgaaacatctgagtggtggcttcaagag
atcaaagatttttatcaaaatgttctgaaatttgatggcatatggatagatatgaatgaa
ccggccagttttgtacatggttcagttgatggttgcactgatgctctgttgaataagcct
ccatacatgccacatttggaatcaagaaatgcgggtctaaatcacaagactttgtgcatg
gaaactcaacaaactcttccagatggaactcttgttagacactatgacgtccacagtctc
tatggatggtcccatgcaaaaccaacatatgatgccctgacaagtgttaccggggaaaga
ggcatcgttgtgagtcgttctacatatccttcagctggtcagtgggtgggacattggctt
ggggacaacactgctgcatggaatcaaattgataagtctgttattggtatgatggaattt
aacctttttggaataccatatattggggcagatatttgtggattctttcaagatactaca
tatgaattatgtgcccgttggatggaactcggggccttttatccatatgccagaaatcac
aatgggaaaggtttcatgagacaagatcctgttagctttgatgaaaactttaagactcta
tccaaaaatgtgcttaatatcagatacaagcttttgccatatctgtacactctaatgttt
gaggcccatactgaaggatctactgttattcgacctttgttgcatgaatttactgcagat
aaaacaacctgggacatttataaacagttcttatggggaccagcatttatgatcagccca
gcacttgaaataaatcagttagtagtaaaggcatatataccaaacacccgctggtataac
tatcacacgggcatccaaattaatgaaagaggaacatgggttgatttaaatactcccctg
gaacatattaatttacacataagaggaggatacatcattccatggcaagaaccagctaac
aatactttttacagtcgacagaagtttatgggggtaattgttgctctggatgaccaaggc
caagcaaaggggaacctattctgggatgacggaaagagtattgattcagtagaaaagggt
caatatcttctaacaaacttcacggcggataagaacacagtaaggaatcaaatattgcac
aataattatgtaacagcagcaaatcctcttcatcttggacatgtttatatttggggagct
ggtaaaaacccagtaagaagtgttacagttacatacgggggcaccacagaaaccatttca
agttttactttccaaaacgaggttttagaaatccatcttgttaataagagatataacctg
gcagaacaaattgaagttgcatggcaaatctaa

DBGET integrated database retrieval system