KEGG   Xenopus tropicalis (western clawed frog): 100379714Help
Entry
100379714         CDS       T01011                                 

Gene name
mgam
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100379714 (mgam)
   00500 Starch and sucrose metabolism
    100379714 (mgam)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100379714 (mgam)
    3.2.1.20  alpha-glucosidase
     100379714 (mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 2697 aa AA seqDB search
MGKKRKFSSLEIILIVLFIIMAIIAVVLVALFATGQSGVRNSSGDPPFEPQCPNIDFIDH
RIDCIPEDVASQEICIQRGCCWSPHDVINVPWCYFTNAHGYEVKGKKNTQAGFEANLQRL
PAPAIYENNIEQLLLAAEMQSNNRFRFKITDPKSKRFEVPHEHIKEFTGSAASNLNYDYK
LLDKPFGIQVIRKSNSRILFDSTIGPLLYADQVLQLSIKLPSSNIYGLGEHVHRQYKHDT
YWKKWAIFTRDEFPNGDGNNLYGAHTFFLCLEDTDGSSFGVFLMNSNAMEVTIQPAPAIT
YRTIGGILDFYVFVGNSPEQVVMEYLELIGRPYMPAYWTLGFHLSRWGYSSLDEVKQVVE
RNRAIGIPYDVQFTDIDYMEEKKDFTYDKVKFKDLPSFAEDLHAHGQRYIIILDPAIANT
PLIDGPYLAYERGTNLGVWVNESDGVTPLVGKVWPGDTVYPDYTNEACTKWWVQECLEFY
KQVPYDGIWIDMNEVSNFVRGSNKGCASNKLNYPPYTPRIKDNVMYSKTLCMDAKQAWGL
HYDVHNLYGYSMALSTEEAIKAVFPGKRSIIFSRSTFAGAGKYSGHWLGDNAANWNDIKW
AIPGMFEFSLFGIPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAETFKHQDPAS
YGADSLLVKTSRHYLNIRYTLLPYLYTLFYKAHTKGETVVRPLLHEFYSDPETWGIDNQF
LWGPGLLITPILNPNSVNAYVYIPDAKWYNYETGTQASWRKQNVDMYIPEDKIGLHVRGG
YIFPTQQPANTTFYSRKNPLGLIIALDDNQAARGDFFWDDGESRGTIESGTHILYEFSVS
NNILDMVVTHAKYTDPDNLKFEEIKIYGVQKSVSEVTVKKGGIVQPSGHTVRYDSNKVLV
ITGLQLVLGESYTVEWNQIEKNFEKYDCHPEPDAYEAKCQSRGCIWEPSDVPKEPWCYFP
SNYGYRVGNVQSTSTGIKMEITKGSMVVSPFGDLSPPISPINVDVIYHENNMLQFKIYDP
NNKRYEVPVPLNLPNSPTSTEAQRLYEVTVTDNPFGLQIRRKSSGAIIWDSQVPGFYFSD
MLLRLSTKLPSPYVYGLGEVEHNTFRHNLNRTVIGLFAKDQPPQEHTNSYGVHPFYMAME
DDGSATGVLLLNSNAMDLTLQPTPALTYQTIGGILDFYMVLGPTPELVVQQYTALIGRPV
MPAYWALGFQLCRYGYQNDAEISDLYNEMKRAQIPYDVQYADIDYMERQMDFTLGASFKG
LPALVDNMRSEGMRFIILLDPAIAGNETKPYPAFTRGVADDVFIKWDDGSGIVWGKVWPD
LPDVFVDESLDFETQVKLYRAYAAFPDFFLDRTAKWWHQEIKEYRENHIRFDGLWIDMNE
PASFVHGTVDGCRNNILNYPPYMPKLESKDRGLSHKTLCMESRQHLPNGNPVRHYDVHSL
YGWSHSKPTFDALRDVTGERGIVISRSTYPTSGQWVGHWLGDNTAAWNQMDKSVIGMMDF
SLFGISYTGADICGFFQDSTYELCARWMQLGAFYPFSRNHNGKGSKRQDPVSFDTAFEDL
SRKVLNTRYTLLPYLYTLLFEAHTKGSTVVRPLLHEFTEDKQTWDVYKQFLWGPALMISP
VMNEGARSVNVYVPNTIWYDYHTGININIKGQWAELQAPLDHINLHVRGGYILPLQAPAN
NTHFSRKNPMKLLVALDQNEMANGQLFWDDGTSITSIERGVYIMYEFSAGPNFVNLTTTN
ANYVDPDNVQFEEIQIHGLAKNIIDLVVKTNNTIQPSNHQVVYDEKTQIAKITGLQLILG
ESYYLEWNTYLSRFDCYPEDNPTKEACENRGCIWDVASIPQVPACFFPSNYGYTVTNVQH
SAHGLTADLQNAVLLPRYKDISNPIQTLRLTVIYHENNMLQFKIDDPNTKRYEVPVPIKT
PSSPTSTQQQRMYDVEIVNNPFGIKIIRRSSGTVIWNSQAPGFTFSDQFIQISTILPSGY
IYGLGETEHRTYRHDLNWVTWGMFAKDQPPGYTINAYGVHPFYLGLENDGNAHGVFLHNS
NAMDVTLQPTPALTYRTVGGILDFYVVTGPTPEMVVQQYTALIGRPLLPAYWSLGFQLCR
YGYQNDKDIEDLYNEMVAAQIPYDVQYADIDYMERQMDFTLSQNFSGLPSLVDKMRSDGM
KIIIILDPAIAVNETKDYPPFRRGIEKDVFIKWADGRGIALGKVWPDLPGVIVDQSLDWD
TQVAIYRAHAAFPDFFKNETSEWWLQEIKDFYQNVLKFDGIWIDMNEPASFVHGSVDGCT
DALLNKPPYMPHLESRNAGLNHKTLCMETQQTLPDGTLVRHYDVHSLYGWSHAKPTYDAL
TSVTGERGIVVSRSTYPSAGQWVGHWLGDNTAAWNQIDKSVIGMMEFNLFGIPYIGADIC
GFFQDTTYELCARWMELGAFYPYARNHNGKGFMRQDPVSFDENFKTLSKNVLNIRYKLLP
YLYTLMFEAHTEGSTVIRPLLHEFTADKTTWDIYKQFLWGPAFMISPALEINQLVVKAYI
PNTRWYNYHTGIQINERGTWVDLNTPLEHINLHIRGGYIIPWQEPANNTFYSRQKFMGVI
VALDDQGQAKGNLFWDDGKSIDSVEKGQYLLTNFTADKNTVRNQILHNNYVTAANPLHLG
HVYIWGAGKNPVRSVTVTYGGTTETISSFTFQNEVLEIHLVNKRYNLAEQIEVAWQI
NT seq 8094 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaagcggaagtttagttctctggaaattatcctcattgtgctattcattatc
atggcaatcattgcagttgtgcttgttgcactgtttgctacaggacaatctggtgtcaga
aatagttcaggggatcctccatttgagccccaatgtccaaacatagatttcatagatcac
aggatagactgtattccagaagatgtcgcttctcaggaaatttgcatacaacgaggttgc
tgttggagtcctcatgacgtaattaatgttccatggtgctattttacaaatgctcatgga
tatgaagtgaagggaaaaaaaaatactcaagcaggatttgaagctaacctccaaaggctg
cccgctcctgcaatttatgaaaacaacattgaacaattactcctagcagcagaaatgcaa
tccaataatcgctttagattcaagattactgacccaaaaagcaaacgatttgaagttccc
catgaacatataaaagagtttacaggttcagctgcatcaaatttaaattatgactacaag
ctgttggacaaaccttttggaatccaagtgataagaaaatcaaattccagaattctgttt
gattctacgattgggccacttctgtatgctgaccaagttttacagctctccattaaatta
ccaagttctaacatctatggcttgggggaacatgttcacagacaatataaacatgatacc
tattggaagaaatgggctatatttacaagagatgagtttcccaatggtgatggaaataac
ttatatggtgcacatacattttttttgtgtttggaagatacagatggatcttcttttgga
gttttcttaatgaacagcaatgctatggaagtaacaattcagcctgcaccagccattaca
taccgaactattggaggtatcctcgatttctacgtctttgtaggcaacagtccagagcaa
gtagtaatggaatacttagagcttattggaagaccttacatgcctgcatattggacactt
ggctttcatttgagtcgctggggctactcatctcttgatgaagtaaaacaagtggtggaa
agaaacagagccattggaataccatatgatgttcagtttactgacattgattatatggaa
gaaaagaaagattttacatacgacaaggtcaagtttaaggatcttccctcatttgccgaa
gatttgcatgcccatgggcagagatacatcatcatactggatcctgctattgccaatact
ccacttattgatggaccttatttagcctatgagcgaggaactaatctaggtgtgtgggtt
aatgagtcagatggagtaacaccacttgttggaaaagtttggcctggagatacagtatat
cctgattatactaatgaggcctgcacaaaatggtgggtgcaagaatgtcttgaattctac
aaacaggtgccatatgatggaatttggattgatatgaatgaagtgtctaactttgtgaga
ggctcaaacaaaggatgtgctagtaataagctaaactatcctccatacacaccaagaatt
aaggataacgtgatgtattccaagactttatgcatggacgcaaaacaggcctggggatta
cattatgatgttcacaacttatatggatattcaatggctttatctactgaagaagccatc
aaagctgttttccctggaaaaagaagcatcattttttctcggtcgacttttgctggagca
ggcaaatactcaggacattggcttggagataatgctgccaactggaatgatattaaatgg
gctataccaggaatgtttgagttcagcctttttggaataccttatattggtgcagacata
tgtggattttttgatgactcttcagaagaactgtgcagaaggtggatgcaagttggtgct
ttttatccattctcaagaaatcacaatgctgagactttcaagcaccaggatcctgcttct
tatggagctgattcacttttagtgaaaacatcaagacactacttaaacattcgctatact
ctgctgccatatctttacaccctattctacaaggctcacaccaaaggggaaactgtagtg
aggccattacttcatgagttctattctgatcctgaaacttggggaatagataaccagttt
ttgtggggtcctggacttctcattacacctatacttaatccgaactctgttaatgcttat
gtatatatccctgacgcaaagtggtacaactatgaaactggcactcaagcctcttggaga
aagcaaaacgttgacatgtacatcccagaagacaaaattggacttcatgtcagaggggga
tacatatttccaactcagcaaccagctaatactacattctatagccgtaaaaatccactt
ggccttattattgctttggatgataaccaggctgctaggggagacttcttctgggatgat
ggagaatccagagggacgatagaatcagggacccatattttatatgaattttctgtttca
aataatatattagacatggtggtcacccatgcaaagtatacagacccagataatctcaaa
tttgaagaaattaagatatatggagttcagaaatctgtcagtgaagtaacagtgaagaaa
ggcggcattgtccaaccctctggtcatacagttagatatgattctaacaaggttttagta
ataacaggtcttcagctggtattaggtgaaagttacactgtcgaatggaatcaaattgaa
aagaactttgagaaatacgattgccatcctgaacccgatgcctatgaggctaaatgtcaa
agcaggggatgtatctgggagccttcggatgtacccaaagagccatggtgttactttcct
agtaactatggttacagagtaggcaatgtgcagtcaacctctactggtataaaaatggaa
attaccaaaggttccatggttgtgtcacctttcggtgatctttcacctcccataagccca
attaatgttgatgtaatatatcacgaaaataacatgctacaattcaagatctatgacccc
aataataaaaggtatgaagtccctgtaccgctaaatctacctaacagtcctacaagtaca
gaagcacaacgcctttatgaggttactgttactgacaatccatttggccttcagatcaga
cgaaaaagcagtggagcaataatatgggattctcaagttcctggattttacttctcagac
atgctgcttcgtctttcaaccaaactgccctcaccttatgtttatggacttggagaagtt
gagcataacacatttcggcacaatttaaataggacagttattggactgtttgctaaagac
caacccccacaagaacacactaactcttatggtgtccatccattttacatggctatggaa
gatgatggaagcgctactggtgtacttctgctaaacagcaatgcaatggatttaacactc
cagccaactccagcactaacatatcaaaccattggaggaatcttggacttctatatggta
ttgggtccaacacctgagctagttgtgcaacaatacaccgcacttattggacgtccagtt
atgccagcttattgggctcttggatttcagctctgccgctatggttatcagaacgatgca
gaaatttctgacctgtataatgaaatgaagagagctcaaattccctatgatgtacagtat
gctgatattgactacatggaaagacagatggactttacactaggtgctagctttaaagga
cttcctgctttggttgataacatgagatcagaaggaatgagatttatcatccttttggat
ccggctatcgcaggcaatgaaacaaaaccgtatccagcttttaccagaggtgtagcagat
gatgtatttattaaatgggatgatggaagtggaattgtttggggaaaggtatggccagac
ctgccagatgtatttgttgatgaatcactggactttgaaacccaagtaaagctttacaga
gcttatgctgcatttccagactttttccttgatcggacagctaaatggtggcatcaagaa
attaaagaataccgtgaaaatcatataagatttgatgggctctggatagatatgaatgaa
ccagcaagttttgtccatggaactgttgacggctgcagaaataatattttgaattatcca
ccgtacatgccaaagttggagtcaaaagatcgtgggttaagtcacaaaactttgtgcatg
gagagtcgacaacacctgccaaatggaaatccagtaaggcactatgatgttcatagtctt
tatggatggtcacattcaaaaccaacctttgatgctctgagagatgtaactggtgagaga
ggtattgttatcagtcgttctacatatccaacatctggacagtgggttggacattggcta
ggggataatactgctgcatggaatcaaatggataaatcagttatagggatgatggatttt
agtctttttgggatatcatatactggagcagatatttgtggattctttcaagattcaaca
tatgaattatgtgctcgatggatgcagttaggagcattttaccccttttcaagaaatcac
aatggtaaaggatccaagaggcaagatcctgtaagttttgatacagcatttgaagacctt
tccagaaaggtcctgaatacaagatatactctgttaccctacctgtacactctgttattt
gaagctcacactaaaggctccacagttgttcgaccattattacatgaattcactgaagat
aagcaaacctgggatgtgtacaaacagtttttatgggggccagcactgatgataagccct
gtcatgaatgaaggcgcaagatctgtgaatgtgtatgtcccaaatacaatatggtatgat
tatcatacgggaatcaatattaatataaaaggccagtgggcagagctacaagcaccactc
gatcatataaaccttcatgttcgaggtggctacatattaccattgcaagctccagctaac
aatactcattttagccgaaaaaatccaatgaaactacttgtggctttagatcaaaatgaa
atggccaatggacaacttttctgggatgatggaacaagtattacctcaattgaaagaggg
gtgtacatcatgtatgaattttctgctggtccaaattttgtaaacttgacaacaactaat
gccaactacgtcgatccagacaatgtgcagtttgaagaaattcaaatacatggacttgcc
aagaacataattgaccttgtggtgaaaacgaataacacaatacaaccatcaaatcaccaa
gttgtttatgatgaaaagacacagattgctaaaataacaggtcttcagctgatcctggga
gaatcgtactatttggaatggaatacctatctttctagatttgattgctatcctgaagac
aatcctacaaaagaagcatgtgagaatcgtggctgcatatgggatgtagccagtattcct
caagtaccagcttgtttcttccccagcaattatggatatactgttaccaatgtgcaacac
agtgcacatggcttaacggcagatctgcagaatgcagtactgcttcctcgttataaggat
atctctaaccccatacaaactcttcgattaacagttatctatcatgaaaataatatgctt
cagttcaagattgatgatcctaacacaaagagatatgaagttcctgtgccaattaaaaca
ccaagcagtccaacaagcacacagcagcaacggatgtatgatgttgaaattgtaaacaac
ccctttggaattaaaattattaggagaagctctggcacagttatttggaactctcaagca
cctggattcaccttctcagatcagtttatccaaatttcaacaatacttccctctggatat
atttatggtcttggagaaacagaacacagaacatatcgtcatgacttgaattgggttact
tggggaatgtttgccaaagatcaaccccctgggtatactataaacgcatatggcgtgcat
cccttttacttaggcctggaaaatgatggcaatgctcatggcgttttcctgcataacagc
aatgcaatggatgtaaccctgcagccaactccagcacttacttatcgcacagtaggagga
attctggacttttatgtagtaacgggtccaactcctgagatggttgttcagcagtataca
gcacttattggacggcctcttttgccagcatattggtctctgggatttcagttatgccgt
tatggataccaaaatgacaaagacattgaagatctctataatgaaatggtagcagctcag
attccctatgatgtgcaatatgccgatattgactacatggaaagacaaatggatttcact
ttaagccagaatttttcagggcttccttcattagttgacaaaatgagatcagatggaatg
aaaatcatcattattttggatccagctattgcagtaaatgaaacaaaagattacccacct
ttcagaagaggaattgaaaaagatgttttcattaaatgggcagatggaaggggaattgca
ttgggaaaggtctggccagatttgcctggtgtcatagttgatcagtcacttgattgggat
acacaagttgcaatttacagagctcatgcagcatttccagactttttcaagaacgaaaca
tctgagtggtggcttcaagagatcaaagatttttatcaaaatgttctgaaatttgatggc
atatggatagatatgaatgaaccggccagttttgtacatggttcagttgatggttgcact
gatgctctgttgaataagcctccatacatgccacatttggaatcaagaaatgcgggtcta
aatcacaagactttgtgcatggaaactcaacaaactcttccagatggaactcttgttaga
cactatgacgtccacagtctctatggatggtcccatgcaaaaccaacatatgatgccctg
acaagtgttaccggggaaagaggcatcgttgtgagtcgttctacatatccttcagctggt
cagtgggtgggacattggcttggggacaacactgctgcatggaatcaaattgataagtct
gttattggtatgatggaatttaacctttttggaataccatatattggggcagatatttgt
ggattctttcaagatactacatatgaattatgtgcccgttggatggaactcggggccttt
tatccatatgccagaaatcacaatgggaaaggtttcatgagacaagatcctgttagcttt
gatgaaaactttaagactctatccaaaaatgtgcttaatatcagatacaagcttttgcca
tatctgtacactctaatgtttgaggcccatactgaaggatctactgttattcgacctttg
ttgcatgaatttactgcagataaaacaacctgggacatttataaacagttcttatgggga
ccagcatttatgatcagcccagcacttgaaataaatcagttagtagtaaaggcatatata
ccaaacacccgctggtataactatcacacgggcatccaaattaatgaaagaggaacatgg
gttgatttaaatactcccctggaacatattaatttacacataagaggaggatacatcatt
ccatggcaagaaccagctaacaatactttttacagtcgacagaagtttatgggggtaatt
gttgctctggatgaccaaggccaagcaaaggggaacctattctgggatgacggaaagagt
attgattcagtagaaaagggtcaatatcttctaacaaacttcacggcggataagaacaca
gtaaggaatcaaatattgcacaataattatgtaacagcagcaaatcctcttcatcttgga
catgtttatatttggggagctggtaaaaacccagtaagaagtgttacagttacatacggg
ggcaccacagaaaccatttcaagttttactttccaaaacgaggttttagaaatccatctt
gttaataagagatataacctggcagaacaaattgaagttgcatggcaaatctaa

DBGET integrated database retrieval system