KEGG   Xenopus tropicalis (western clawed frog): 100379715Help
Entry
100379715         CDS       T01011                                 

Gene name
plcd4
Definition
phospholipase C, delta 4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100379715 (plcd4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100379715 (plcd4)
   04070 Phosphatidylinositol signaling system
    100379715 (plcd4)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100379715 (plcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 758 aa AA seqDB search
MTSPCSARLQLNENLQLMQAGSLMRKVKSRSWKKQRYFKLQEDCMTIWYNSKKTGNTKST
FSISDIETVREGHQSEVLQSIADEFKPELCFTIVFHGRRANLDLVANTPEEAQCWIQGLE
KLIETVTNMDQKDLLDQWICDWFQKADKNKDGRMNFKEVQDLLKMMNVDMSEHHAYRLFQ
MADKSESGTLEGEEFVLFYKALTQRDEVLKIFQDFSKDGKKLTLLEFVDFLQQGQLEEEN
TEELAMDLIARYEPSDTAKKLHAMSIDGFVMYLCSPEGSIFNVAHEQLYQDMTQPLCHYF
ISSSHNTYLMEDQIRGQSSVEGYIRALKRGCRCVEVDTWDGPNGEPIVYHGRTFTSKILF
KDVISAINKYAFRVCDYPVILSLENHCGVEQQDAMAQHLKSILGTKLIMSTLDGRIPTCL
PSPDELRGKILLKGKKIGRLVDSLEEQPDDSVGEVTDEEENVEVEEERNEDKKRAKKSKE
RLSHLLSDCVIYCKSVPFVSFQHSRAHYTLYEMSSVTEYKARKLVREPGNDFVRHNAWQL
MRVYPTGLRTDSSNYNPQEMWNVGCQMVALNFQTAGVEMDLNDGLFRQNARCGYVLKPSF
MRHVETTFNPDQPQSTEGYSPVNLSILVISAQQLPKVENSKEGSIVDPFVRVEIFGVPID
QTKQETKYIENNGFNPMWYETLHFKIHVPELALVRFVVEDYDKTSRNDFVGQYTLPFKSI
KSGYRHIHLLSRDGTKMPPASVFVHVRVTDASQPEQDT
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgacatccccctgctctgcccgcctacagctgaacgagaacctgcagcttatgcaggcc
ggctcccttatgagaaaagtgaaatcccgcagttggaagaaacagagatatttcaaactg
caggaggactgcatgactatatggtacaactccaagaaaactgggaatacaaagtccaca
ttttccatcagtgacattgagacggtgagggaagggcaccagtcggaagtgctgcagagc
atcgcagatgagttcaagcctgagctctgctttaccatcgtcttccatggacgtcgagcg
aacctcgacttggtggccaacaccccagaggaggctcagtgctggatccaaggcctggag
aaactgatagagacagtgacaaatatggaccagaaggacttgctggatcagtggatctgc
gactggtttcaaaaggccgacaagaacaaagatggaagaatgaacttcaaagaggtccag
gatctgctaaagatgatgaatgtggacatgagtgagcaccatgcttaccgacttttccag
atggcagataagtccgagtcaggaaccttagaaggagaggagtttgtgctgttttacaaa
gctctgacacaacgtgatgaagtgctaaagatctttcaggacttctccaaggatgggaag
aagctcaccctgttggagtttgtggacttcctacagcagggccaactagaggaggagaac
accgaggagctagccatggaccttattgcacgttatgagccgtcagatactgcaaagaag
cttcatgctatgagcatagacgggtttgtcatgtacctgtgctccccggagggatccatc
ttcaatgtggcccatgagcagctctaccaggatatgacgcaaccattgtgccattacttc
atctcatcctcccacaacacctacctgatggaagaccagatccgaggacagagtagcgtt
gagggatacatcagggcactaaaacgaggctgccgctgtgtagaagtggacacctgggat
ggacctaatggagaacccattgtgtatcacggacgcactttcacatctaaaatccttttc
aaagatgttatttccgccatcaacaagtatgccttcagggtatgtgactacccagtcatc
ttgtccttggagaatcactgtggggtggagcaacaggacgccatggcgcagcacctgaaa
agcattctgggaaccaaactcatcatgagcaccctagacggtcgaattcctacctgcttg
ccgtctcctgatgagcttcgagggaagatcctattaaaggggaagaaaatcggtcgattg
gtagacagcctggaggagcagcctgatgattcggtgggtgaggtgactgacgaggaagag
aatgtggaggtggaagaggagcgaaacgaggataaaaaaagagcaaaaaaatccaaagag
cgcctctctcatctgctatcggactgcgtaatttactgcaagagcgtgcccttcgtcagc
ttccagcactccagagcccactacacactttacgagatgtcgtcggtcacagagtacaag
gctaggaagcttgtcagagaaccagggaatgattttgtgcgacacaacgcctggcagctg
atgcgcgtttaccccacaggactccggacagattcctccaactacaacccccaagaaatg
tggaatgtggggtgccagatggtggcgctgaacttccaaacggctggagtagagatggat
ctgaacgacggcctcttccgacagaacgctcgctgtggctacgtgctgaagccttccttc
atgagacatgtagagaccacattcaatcctgaccaaccgcagagcacggaaggctactca
cccgtcaatctctccatactggtgattagtgcccagcaactgcccaaggttgaaaacagc
aaagaaggttctatagtggatccttttgtgagagtggagatctttggggttcccattgac
caaaccaagcaggagacaaagtacatagaaaataatgggtttaacccaatgtggtacgag
acactacacttcaaaatccacgtccctgaactggcgctcgtcagatttgtggtagaagat
tatgacaaaacctcaagaaatgactttgtcggacaatatactctcccgttcaaaagcatc
aaatccggatatcggcacatccacctcctttcacgggacggcaccaagatgcctcctgcc
tctgtatttgtccacgtccgcgttacagatgcatcgcagcccgagcaagacacgtag

DBGET integrated database retrieval system