KEGG   Xenopus tropicalis (western clawed frog): 100379835Help
Entry
100379835         CDS       T01011                                 

Gene name
usp22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100379835 (usp22)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100379835 (usp22)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100379835 (usp22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 572 aa AA seqDB search
MSGSWNPPKEFLLRQSWEGVRLSALSSSSLGSSPSCPRTPHLVSGCGFVMSPAGCSHVNS
FKVENWKQNLRVIYQCFVWSGTPETRKRKAKSCICHMCGAHLNRLHSCLYCVFFGCFTKK
HIHEHAKNKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQVAKEEQRKAWKLQAFSPALVSP
YQYAMTGVGEKYSTWEPTKRELELLQHNPKRRKITTNCTIGLRGLINLGNTCFMNCIVQA
LTHTPLLRDFFLSDRHKCEMQSPNSCLVCEMSTLFQEFYSGHRSPHIPYRLLHLVWTHAR
HLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQV
CHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDSAVVNGESHVSGTTTLTDCLRRFTRPE
HLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELD
MTPFMASSKESRMNGQYQQPSDSLHNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFK
CDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttcttggaacccaccaaaggagtttttgctgagacaaagttgggagggggtg
aggctttctgccttgtcctcctcctccctggggagcagtccttcctgtcctcggacccca
cacctagtgagtggatgtgggtttgtcatgagtccggccggctgctcccatgtgaacagc
tttaaggtggagaattggaagcaaaacctgcgagttatttaccagtgctttgtgtggagt
gggactccagaaaccaggaagaggaaggctaaatcgtgcatctgtcatatgtgtggagct
cacttgaacagacttcactcttgtctctactgtgttttctttggctgctttacaaagaaa
catattcacgaacacgcaaaaaataagaggcacaatctggctatagatctattgtatggg
ggtatatactgctttatgtgtcaagattatatatatgacaaagatatggagcaagttgcc
aaagaagaacaacgtaaagcttggaaattgcaagctttctccccagcactggtttctcca
taccagtatgcaatgactggagttggagaaaagtattcaacgtgggagccaacaaagcgg
gaactagagctgttacagcataaccccaagagaagaaaaattacgacaaattgtactata
ggtttgcgaggtttaattaatcttgggaacacatgttttatgaactgtattgtccaggca
cttacccacactcccttgctgcgcgatttcttcctttcggacagacataaatgtgaaatg
caaagccccaactcttgccttgtttgtgaaatgtctacgctctttcaggagttttactct
ggacatcgttctcctcacattccgtataggttactgcaccttgtatggacacatgcacga
catttagcagggtacgagcagcaagatgcacatgagttcctcattgctgctttagatgtt
cttcacagacattgcaaaggtgatgataatggaaaaaaggccaacaatccaaaccactgt
aactgtatcatagaccaaatcttcacaggaggcctacagtcagatgtaacctgtcaagtg
tgccatggggtctctactactatagatccattttgggatatcagcttagatctgccaggt
tcttcgactccattctggcctctgagcccaggaagtgattctgctgtggttaatggggaa
agtcatgtgtcaggaacaacaacactcacagactgtctcaggaggtttacacgaccagag
catctaggaagtagtgccaaaatcaaatgcagtggttgccatagttaccaggaatctact
aaacagctgaccatgaagaaattgcctattgtggcttgttttcatctcaaacgatttgag
cattcggctaaactgaggcggaagattacaacatacgtgtcattcccgttggagctggac
atgacgccatttatggcctcaagtaaagagagccgaatgaatggacagtatcagcaacca
tctgatagtttacacaatgacaataagtattccttgtttgcagtagttaatcaccaagga
accttggagagtggacattacacaagcttcatcaggcaacacaaggaccagtggttcaaa
tgtgatgatgcaattatcaccaaggctagcattaaagatgttctagacagtgaagggtat
ttgcttttctatcacaagcagtttctggagtatgagtaa

DBGET integrated database retrieval system