KEGG   Xenopus tropicalis (western clawed frog): 100379890Help
Entry
100379890         CDS       T01011                                 

Gene name
aox1, aoh1
Definition
aldehyde oxidase 1
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100379890 (aox1)
   00350 Tyrosine metabolism
    100379890 (aox1)
   00380 Tryptophan metabolism
    100379890 (aox1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100379890 (aox1)
   00760 Nicotinate and nicotinamide metabolism
    100379890 (aox1)
   00830 Retinol metabolism
    100379890 (aox1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100379890 (aox1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100379890 (aox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1264 aa AA seqDB search
MISTVHPVSKKIIHYPALACLLPICSLYGNAVTTTEGIGNSTTKLHPVQERIAKAHGSQC
GFCTPGMVMSIYTLLRNHPEPTMEQILSALSGNLCRCTGYRPILDGCKTFSKDCCLNEKK
EHRLEEVKSFPKLFYEKDFLPLDPTQDLIFPPELMMMFNSQKKMNVFLGERITWYSPSTL
DEILELKTKYPSAPLVVGNTALGPQMKFQGVIHPVLISPVRVMDLYNVSLNDMGISIGAA
CSLSQVKEILCENISAIQEDKAKIFHALLQHLGTLAGEQIRSMASIGGHIISKRTISDLN
PILAAGGAILNFASKGETRQVELNELFFTGSSPQKSEEVLLSVFIPYSKKDEFVSAFRQA
QRDENANAIVNAGMKVHFEEDTDIVKEMAIYYGCMGPSTVYAKNTSQALIGRHWDEEMLN
EACKLILEEITLSPSAPGGKVQYRRALTISFFFKFYLQVLQCLKKTIKSSSVASDYISAI
KDFEINTPKTLQIFQETEQEQPTDDPVGHPIVHTSGIKQATGEAIYVDDMPTVDQELFIA
FVTSKRAHAKILSIDASEALALPGVCDIIRAEDIPGKNELDGLNHLFSEDKVECVGQIIC
AVVADTPKHAKQAAAKVKIDYQNLEPVILTMEDAIKNNSFFEPEKKIIHGNAEEAFKSAD
HILEGEVHIGGQEQFYMETNTVLVVPKGEENELDIYVSTQDPTGVQLAVAACLNVPSNRV
MCHVKRVGGAFGGKITKPSIFACASAVAAHKTKRPVRCVLERGEDMLITAGRHPFFGKYK
VGFMNDGRIVGLDVSFYTNAGCTTDESILVLVVALIKMDNAYHFPNLTCTATACKTNLPS
NTAFRGFGFPQTGLVTETIMDAVAVKCGLQPHQVREKNMYSGIGKTHYNQEFDSTNLMRC
WNECMQKSSYQSRRDAIQEFNKENYWKKKGIAIIPLKFTVGFVEKTYHQAAALVHIYRDG
YVLVSHSGVEMGQGLYTKIVQVVSRELKIPMSYIYICETSTVTVPNSIASGGSIGTDITG
IAVKNACDILQQRLEPIISGNPNGKWEEWVSEAFEQRISLSSTGYYRGYDTYMDWEKGEG
HAGPYYIFGAACSEIELDCLTGKYNNLRTDIVMDLGQSINPGIDIGQVEGAFTQGFGLYT
TEELQYSPFGSLYTLGPDKYIMPAVCDIPREFNVYLLASSNNPYTIYSSKGVGETALFLG
CSVFFAIKDAIDSARAERGLSKDFTLNSPAGPERIRMACSDYLTNMIPKDEAGTYNPWCV
DVSK
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgatctccactgtgcacccagtctccaagaagataatacactatccagcattggcttgc
ctcctccctatatgttctctctatggaaatgctgtgacaactacagaaggaataggaaat
tccacaaccaaactgcacccggttcaggagagaatagccaaagctcatggatctcagtgt
gggttctgcacgcctggaatggtgatgtctatatacaccttgctaaggaatcacccagaa
cccacaatggagcagatactgagtgctttgtcaggaaacctctgtcggtgtacaggatat
aggccaattcttgatggttgtaaaactttttccaaagattgttgtttaaatgagaaaaaa
gaacataggctggaagaagtaaagagctttcctaaactgttttatgaaaaagacttcttg
cctttggatccaacgcaggacctaatcttccctccagagttaatgatgatgttcaatagc
cagaaaaagatgaatgttttcctcggagaaagaataacgtggtattctccttcaacactt
gatgaaattctagaactgaagactaagtatcccagtgcaccccttgttgttgggaataca
gccctaggtcctcagatgaagttccaaggagtcattcaccctgtgctcatctcaccagtc
agggtcatggatctgtacaatgtcagcttgaatgatatgggaatatctattggagctgcc
tgcagcctctctcaagtcaaggagattctttgtgagaatatatctgctatacaggaagat
aaagccaagatattccatgcacttctacagcatctcggcacactggcgggagagcaaatc
cgcagcatggcgtctataggaggacacatcatcagcaaacgtaccataagcgacttaaac
ccaatacttgctgcaggaggtgccatactgaattttgcttccaaaggagaaactagacag
gtcgaactgaatgaattatttttcactggctcatcaccacagaaatcagaggaagtcttg
ctctctgtctttatcccttattctaaaaaggatgagtttgtgtctgcctttagacaagct
caaagagatgaaaatgcaaatgcaattgtaaatgctggaatgaaagtccattttgaagaa
gacactgatattgtgaaggaaatggccatttactatggctgtatgggaccttcaactgta
tatgcaaagaacaccagtcaggcccttataggaaggcactgggatgaggagatgctgaac
gaagcttgcaaactgattctggaagaaattactctctcgccttcagctcctggaggaaaa
gtgcaatacaggcgggctcttactatcagcttcttctttaaattttacctgcaagtccta
cagtgtctgaagaaaacaatcaaatcctcttctgtggcctcagattatataagtgcaatt
aaagactttgaaataaatacaccaaagaccttacagatttttcaggaaactgaacaagaa
cagccaactgatgatcctgtcggacaccccatagtgcacacatctggtatcaaacaagcc
actggggaggcaatatacgtggatgatatgcctacagtggatcaagaacttttcattgct
tttgtcaccagcaagagagctcatgctaaaatattgtcaattgatgcatctgaagctctt
gcacttcctggtgtgtgtgatattataagagcagaggacatcccaggaaagaatgaactg
gatggattgaaccatttgttttcagaagacaaagtagagtgtgtgggtcaaataatctgc
gcagttgtggcagatactccaaagcatgcaaagcaagctgccgccaaagtgaagatcgac
taccaaaatctagaacctgttattcttactatggaggacgctattaaaaataattcattt
tttgagcctgaaaagaaaatcattcatggaaatgcagaggaagcttttaaaagtgctgac
cacatccttgaaggtgaagtccacattggaggacaggaacagttctacatggaaaccaat
actgtgcttgttgtgcctaagggagaagagaatgaacttgacatctatgtatcaacccaa
gatccaactggtgtacagcttgcagttgctgcttgccttaatgttccttctaacagagtt
atgtgccacgtgaagcgtgttggaggcgcgtttggaggcaagatcactaagccatccata
tttgcctgtgcttcagcagtggctgctcacaagaccaaacgccctgttcgttgtgttctg
gagcgtggggaagacatgcttattactgcaggacgccacccattctttggaaaatacaaa
gtgggatttatgaatgatggcaggattgttggactagatgtttctttctataccaatgct
gggtgcaccacagatgaatcaatcttggtcttagtggtggccttgataaagatggacaat
gcctaccactttcccaacctaacatgtaccgctaccgcatgtaagactaaccttccatcc
aacaccgctttccgtggctttgggtttccccaaactggcctggttactgagaccatcatg
gatgcagtggctgtaaaatgtgggctacaacctcatcaggtgagagagaaaaacatgtac
tcaggaattgggaaaacccattacaaccaagagtttgattctactaatctgatgcgatgc
tggaatgagtgtatgcaaaagtcaagctaccagagcagaagagatgccattcaagagttt
aacaaggaaaactactggaaaaagaagggaattgccattatacctctaaaatttacagtt
ggctttgttgagaaaacatatcatcaggcagctgctctggtgcatatttacagagatggc
tatgtacttgttagtcacagcggtgtggagatgggtcagggactttacaccaagattgta
caggttgttagccgagaactaaagatacccatgtcttatatttacatatgcgaaaccagc
acagttactgtaccaaattctatcgcatctggaggctctatcggaacagatataactggg
attgctgttaagaatgcatgtgatatccttcaacagagactggaacccataatcagtggg
aatcccaatggcaaatgggaggaatgggtttcagaggcctttgaacaaagaattagcctt
tcatcaactggatattacaggggatatgacacttacatggactgggagaagggagagggt
cacgctggtccttattatatttttggtgctgcatgttccgagatcgagcttgactgtctg
actggaaagtacaataacctgcgcactgatattgttatggacctgggacagagcattaat
ccaggaatagacattggacaggttgaaggggcatttacccaaggatttggtctgtacaca
acggaggaacttcaatattccccttttgggtcattgtacacattgggccctgataaatat
ataatgccagctgtgtgtgatattccaagagaatttaatgtttatttactagcttcatcc
aataatccatataccatctactcatcaaagggtgttggtgagactgccctgttcttgggg
tgctctgtgttctttgctatcaaagatgcaatagactctgctcgtgccgaacgtgggtta
tccaaggacttcaccttaaacagtccagcaggtcctgagaggatcagaatggcttgctca
gattatctaaccaacatgatccccaaagatgaagctggtacctacaacccatggtgtgtg
gatgtgtccaaatga

DBGET integrated database retrieval system