KEGG   Xenopus tropicalis (western clawed frog): 100380070Help
Entry
100380070         CDS       T01011                                 

Gene name
bckdk
Definition
(RefSeq) branched chain ketoacid dehydrogenase kinase
  KO
K00905  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     100380070 (bckdk)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100380070 (bckdk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 100380070
NCBI-ProteinID: XP_002940756
Xenbase: XB-GENE-994837
Position
9
AA seq 413 aa AA seqDB search
MFRKNLLDLAGRGALKPVPVSLSLLPIRSRSTSATDQNHVELARERSKTVTSFYNQSGID
ISAEKASVRLTPTTMLYSGRSQDGSHILKSARYLYKELPVRISHRIKGFRSLPFIIGCNP
TILHVHELYIRAFQKLSEFPPISNHETESQYCKLLRQLLDDHKDVVTQLAEGMRESRKHI
QDEKVIRYFLDKTLTSRLGIRMLATHHLALHEDRPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNSMRATMESHIETPYNVPDISI
TIANNDIDFIIRISDRGGGIPHDHMERVMDYHFTTAETSAQDPRINPIFGNMVDMVNSGQ
SGPMHGFGFGLPTSRAYAEYLGGSLCIQSLQGIGTDAYLRLKHIDGKEESFRI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttccggaagaacctgttggatttggcaggccggggggccctgaagcccgtaccggtt
agtctgtcgctgctgcccatacgttctcgctccacttctgccacagaccagaaccacgtt
gaactggcgagggagcgctccaaaacagtcacctctttctataaccaatccggcattgat
atttcagcagagaaggcctctgtccgcctcactccaaccactatgctgtactcagggagg
tctcaggatggcagccatattctgaaaagcgctcgctacttgtacaaggagctcccggtc
cggatttcccatcgcatcaaaggcttccgcagtctcccgttcatcatcggctgcaaccca
acgatcctgcacgtgcacgagctgtacatccgagccttccagaagctcagcgagttccct
ccgatctctaaccacgagacggagagccagtactgcaagctcctgcgccagctgctcgat
gatcacaaggatgtggtgactcagttggccgaggggatgagggagagcaggaaacacatc
caggatgagaaagtcatcagatatttcttggataagactttaacgtcgcgcctgggcatc
cggatgttggcaacgcaccacctggctctgcacgaggaccggccagactttgttggcatt
atctgcacccgcctctcacctaagaagatcattgagaaatgggtggactttgccaggcgt
ctgtgtgagcacaagtacgggaatgccccccgagtccgcattaatggtcacgttgccgct
cgattccctttcatccccatgccgctggattacattctcccggagctgctcaaaaactcc
atgcgggccaccatggaaagccatattgaaacgccctacaacgtcccggacatttcaatt
accatcgccaacaacgacattgacttcataatccggatctcagaccgaggaggtgggatc
ccacatgatcacatggagcgggtaatggattaccacttcaccacggcagagaccagcgct
caggatccccgcatcaacccgatttttgggaacatggtggacatggtgaacagcggccaa
tcaggccctatgcacggtttcggctttggcctgcccacgtcccgggcctacgcggagtat
ctgggcggctccctgtgcatccagtctctgcagggcatcggcacggacgcctacctgcgg
ctcaagcacatcgacggcaaagaggagagcttccgcatctga

DBGET integrated database retrieval system