KEGG   Xenopus tropicalis (western clawed frog): 100380090Help
Entry
100380090         CDS       T01011                                 

Gene name
ppox
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xtr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 474 aa AA seqDB search
MQRTVVVAGGGISGLTACYHLAKDASVPKVILLEGSSRLGGWMRSTRTEDGAVFEHGPRG
IRPGGTVGRNTLCMISELGLEQEILPVPRSHPAAKERYLYVNKTLHKLPSSIGGVLRTIP
PFTRPLFLCGLRDLAAPRGSKEDESIYDFVSRRFGKELADIVIDSLCRGVFAGDCRKLSV
RSCFPFLYEAEVKRRSVILGMATGGDKGPPVDSELIRRSKQERWSQWSLQGGMQTLSEAL
EDFLRKRGVEIHKDTPIRQLERTADNGWKIKLPDGSITADYILSALPAKDLGCLLPPDLE
PLVKELRQMSSATVAVVNLQYEGQVLPISGFGHLIPSTEERALLGIVYDSIAFPQHNKRG
SSSTRLTVMLGGAWFESSIGDPDAVSSEKVLELAKTAAAEQLGVRDKPSRSIVNINKDCI
PQYTLGHWRRTGNISAYTRQLSLPLSLIGASYHGVSVNDCIYNARQAVHSLLGH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggacggtggtggttgccggagggggtatcagcggactgactgcttgttatcat
ctggccaaagatgccagtgtgcccaaggtcatactgctggagggaagcagccggctgggg
ggctggatgcgctccacgcggacagaagatggcgctgtgtttgagcatgggcccagaggg
atccggccgggagggacggtggggagaaacaccctgtgtatgatatcagagctcggctta
gaacaagaaatcctcccggtgccccggagtcaccctgcggccaaggagcgctacctctac
gtcaacaaaactctgcacaaactgccttccagcataggcggggtgttgcggaccatcccc
ccctttacaaggccgctgtttctctgtgggctccgggatctggctgcgccgcggggctcc
aaggaggacgagagcatctatgactttgtcagcaggcgttttgggaaagagttggcagac
attgtcatcgacagcctgtgccgcggggtgtttgccggggactgccgaaaactcagtgtg
cgctcctgtttcccgttcctttatgaagcagaggtcaaacggagatcggtcattctgggg
atggcgacaggcggggataagggcccccctgtggattctgagctgatccgaagatccaag
caggagcgctggagccagtggtccctgcagggtgggatgcagaccctgtctgaggcgctg
gaggatttcctgaggaagagaggggtagaaattcacaaggacactcccataaggcagttg
gagaggacggcagacaatggctggaagatcaagcttcccgacggcagcatcaccgccgat
tatatactcagtgctctcccggctaaggaccttggctgcctgctccccccagacctggag
ccgttagtgaaggagctgcggcagatgagttcggccacggtggctgtagtgaacctgcaa
tatgaagggcaagttctgcccatttcgggcttcgggcacctgatcccatcaacggaggag
cgggcgctgcttgggatagtgtatgactccattgccttcccacagcacaacaagcggggc
tccagctccacccgacttacggtgatgctggggggcgcatggtttgaaagcagcataggg
gaccccgacgccgtgtcctccgagaaggtcctagaattggccaagactgcggccgctgag
cagctgggggtgcgggacaagccgagccggagtattgtgaacattaataaggactgcatc
cctcagtacacgctgggacactggcggcgcacagggaacatctccgcctacacgcgccaa
ctttccttgcccctgagcctcattggcgcctcttaccatggcgtctccgtgaatgactgt
atatataacgccaggcaagccgtgcacagcctgctggggcattag

DBGET integrated database retrieval system