KEGG   Xenopus tropicalis (western clawed frog): 100485165Help
Entry
100485165         CDS       T01011                                 

Gene name
flnb
Definition
(RefSeq) filamin B
  KO
K04437  
filamin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100485165 (flnb)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100485165 (flnb)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100485165 (flnb)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100485165 (flnb)
  Intermediate filaments
   Intermediate filament-binding proteins
    100485165 (flnb)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100485165 (flnb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
Un
AA seq 2603 aa AA seqDB search
MPVTEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFSQMQLENVSVALEFLERENIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPVWEDEGDEETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAP
GLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNR
EEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAK
GPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYK
PIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVRIRETADFRVDT
KAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPF
EVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQ
GDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTG
CIVSTPAEFAVDPTDAGKAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVA
VTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSV
GIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRIKV
DPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGDAVKDFEII
DNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVEVG
KDQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVS
YDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG
PCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIAT
GPGLEHGKVGEAGLIHVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFA
GMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLT
KTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFK
VGVTEGCYPDRVKAQGAGLTEALTNKPNLFSVITRGAGIGGLGITVEGPSESKMSCKDNK
DGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGLGTAVRAKI
PQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYAD
EEIPRSPFKVKVLPTYDASKVTASGPGLCAQGISASLPVNFAVDAKNAGLGPLSVQITDQ
EGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRAMSIGDASKCTV
AGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYYTTA
KTGPYVIHVRFGGADIPNSPFTVMATDEVPVQVQQQSLSACPPGYQPLVSETDYAQVGSM
NGLSFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELA
IKCNGAHIPESPLQFFVNYPNTGSVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIE
GPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSRRRSQVK
LGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIK
KNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAV
EGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMGEGRVKESI
TRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVP
QETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPFLVP
IVATSDDARRLTVTSLQESGLKVNQPASFAIRLNGARGKIDAKVHSPSGAVEECFVTELE
PDKYAVRFMPRENGIHMIDVKFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTT
GKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIGVKYGGP
NHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETTYSALPRFASDATKVTSKG
AGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERG
DYMLVVKWGEEHIPGSPFHITVP
NT seq 7812 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgacggagaaggacctggcccaggacgcgccatggaagaagatccagcagaac
accttcacccgctggtgcaacgagcacctcaagtgcgtcaataagcgcatcggcaacctg
cagaccgacctgagcgacgggctgcgactgatcgcgctgctggaggtgctcagtcagaaa
aggatgtaccgcaagtaccaccagagacccaccttcagccagatgcagctggagaacgtt
tcggtggccctggagttcctggagagggagaacatcaagctggtgtctatagacagcaaa
gctattgtggacggcaacctaaagcttatcctcggcctgatatggacccttatcctgcat
tattccatctccatgcccgtttgggaagatgaaggtgatgaggaaaccaagaaccagacg
ccaaagcagagacttctgggctggatccagaacaaaatccctcagctgccaatcaccaat
ttcagccagaactggcaggatggaaaggcactgggagctctggtggatagctgtgcccca
ggattatgtcccgattgggaatcttgggaccctaagaagccggtggagaatgccagggag
gctatgcagcaagctgatgattggctaggagtccctcaggtgattgctccagaagaaatc
attgatccgaatgtggatgaacactctgtaatgacctacctgtcacagttccctaaagcc
aaattaaagcccggggcacccttgaagcccaaactgaacccgaagaaagccagagcttat
ggattaggtgttgaaccaactggtaatatggtgaaaagatcagcaccgtttactgtggag
accatcagtgcagggacaggcgaggttctggtgtacatagaagatccagaaggcaacagg
gaagaggccaaggtcacaggaaacaatgacaagaacaaaacattttcagtggagtatgtc
cctaaagttacaggcatgcataaggtcacggttctgttcgccgggcaacatattgcaaag
agtccatttgaggtcaacgtcgagaaggctcagggagatgccagcaaggtgaccgccaaa
gggcccggcttggagcctatcggaaacattgccaataagccgacgtattttgacatttat
acagcaggggcgggagtaggggacattggcatcgaagtgatcgacccccagggcaggaac
aacacagtggaactggccctcgaggataaaggcaattgtgtctaccgatgtacatacaag
cccattaaagccggacctcacaacgtcgccatcaactttggaggtgaagccacaccaaaa
agcccttacctggtcagcattggtgaagcctgcaaccccaatgcctgccgagccaacgga
cgtggcctgcagcccaaaggcgtcagaatccgagaaactgctgattttagggtcgacacg
aaagctgcaggaagtggcgaccttcatgtttctgtcaaagggccaaagggcttggacgag
gtgctgaaacagtcggaatccctggatggactccatttatttgagtactatcccctgact
cccgggaagtatgtggtcgcaatcacgtggggcggccatcacatcccaaagagtccattt
gaggtccaggtggctctggaagctgggccccaaaaggtacgcgcttggggtcctggactg
tatagtggaatggctggaaaggctgcagactttgtggtggaatctgttggctccgaggtt
ggctccttaggttttgccatagaaggtccctctcaagccaaaatcgaatgcgaagaccaa
ggcgatgggtcatgtgacgtcagatactggccaaaggagccgggggaatatgccattcac
atcatgtgtgacgatgaggacattcagaatagcccgtacatggccttgatccagcccgcg
tccggagacatagatcctgataaggtgaaagcttatggcccagggctggagaaaactggc
tgcattgttagtacccctgctgagtttgctgtagatccaacggatgctggaaaagcagca
ttaaagatctattcccaggatgtggaagggaatccagtagatatcatgaccaaagagaag
ccagatggtacctacgcctgctcatacacacctgccaagccaatcaaacacacagtggct
gtcacgtggggcggagtcagcgtgcctaacagtccatttagggtcaatattggacaaggc
agccacccacatttggttaaggtttttggccccggtgtggagaaaactggtttgaaagca
aatgagccgactcactttacagttgactgcaccgaggcaggagaaggtgatgtgagcgtc
gggattaaatgtgacgcgcgcgtgatcagcgatgaggaggaagatattgactttgatatt
attcccaacgctaacgacacctttaccgtgaaatatatgccaccggctgccgggcgttat
accattaaagtgctcttcgccggagaagaaattcctgaaagtccctttagaatcaaagtc
gatccctcgcacgatgccagcaaagtgagggccgaggggccaggactgagtaaatctggt
gttgaaaacgggaaaccctcacactttaccgtctataccaaaggcgcagggaaggcgccg
gttgatgtttcctttactggacctgccccaggggatgcagtgaaagactttgagatcata
gacaactacgattactcacacaccgtccgatacactcccgtacagcagggcaaaatgaaa
gtggctgtaaattatggcggcgaccctatccccaagagtcccttcaccgtaggtgtggca
gcaccactggacctgaacaagatcagaataaatggcctggaaagtagagtggaagttggt
aaagatcagcagtttattgtggaccctaatggagctggtggacaaggaaaactggaggtg
aagatctccagcccgagtcggaaatcagtcccgtgtttggtggaacctgttcctggtaat
gagtgcagcactgtcaaatatattcccaaagaggagggtctctacaacgtggatgtgagt
tatgatgggaatccagttcctggaagtccatatgtagtggaagccactttgcctccagat
ccttcaaaggttaaggcctatggaccaggtctggaaggaggtcttgttggaaagcctgct
gaatttaccattgatacaaaaggagccggaactggtggcttgggtctgaccgtcgaaggt
ccttgtgaagccaagattgaatgttctgacaatggtgatggcacatgttctgtctcctac
cttcctactacaccaggagaatattttgttaatattctttttgaggaaacccacattccg
gggtcaccttttcaagcgaacgtggaaatgccctttgatccttccaaagtaattgccaca
ggtccaggccttgagcatggcaaagtaggagaagcgggcttaattcacgtggactgttcc
caagcaggaccaggtaacctggcagtagaggctgtctctgattctgggtcaaaggcggaa
gtcaacgtacaggataacaaggatgggacttacacggtcacctatgtgccactttttgct
ggcatgtatacactagcactgaaatatggtggagaacaagtgccaaagtttcctgcccga
gttaaagttgatccagccgtggataccagtaagatcaaagtgtttggaccaggaatagaa
gaaaaaggagtttttagagaagctacaaccgactttaccgtggatgccaaatcactaacc
aaaaccgggggcaatcacgtcaaaaccaaaattaccaatccatccggagcgtccaccgat
taccttcttagagacaatggagatggcacttactacgtagagtacactccttttgaaaaa
ggcgctcatgcaattaaggtgacctacgatgacgaaccggtccccaacagcccattcaaa
gtgggagtgacagagggctgctaccctgatcgcgtgaaagcccaaggtgctggactcaca
gaggctttgacaaacaagccaaatttgttttcagtcattacaaggggggctgggattggc
ggcctaggaattacagtggaaggaccctcagaatccaaaatgtcttgtaaagacaacaag
gatggcagctgcagtgtggaatacactccctatgtcacaggggactatgatgtgaatatt
acatatgatggagagcatattccaggcagcccattcagagtaccagtgaaagatgttgtg
gatcccagcaaggtcaagatatctggccctgggctgggaacagcggtacgagcaaaaatc
cctcagcagtttacagtagataccagcaaagctggcattgcgcccctggcagtgcaagtg
acaggaccaagagggacggtggaaccggtagacctggtggataatggagacgggactcac
acagtcagttacacgcccacgctggagggcccctacaccgtagctgttcagtatgcagat
gaagagatcccgcgaagtccctttaaggtaaaggtcttgccaacgtacgatgccagcaag
gtgactgccagtggtcctggcctctgcgctcaaggaatttccgccagcctcccagttaat
tttgctgtagatgccaagaatgccggactgggacccctgtcggtccaaatcacggatcaa
gaagggaagccaaagaaagcgcagattcaggacaacaacgatggcacctattctgtgtct
tacatcccggacaggactgggcgataccacgttgctgtcaaatatggaggagatgacatc
ccttactccccgtacagaatccgcgccatgtccataggagatgccagcaagtgcactgta
gcaggtcctggtatccaggcagcagtaaaaactggcgaagaggttggttttgtagtagat
gccacaactgccggcaaagggaaagtcacgtgcagcatccttggcccagatggtttggag
aatgaagcagatgtgattgagaatgtggacggcacttatgacatttactacactacagct
aaaacgggaccgtacgtcatccatgttcgctttggcggagccgacatccccaatagcccc
ttcactgtgatggctacagatgaagtccccgtacaggtgcagcagcagtcccttagtgca
tgtcctccaggctaccagcccttggtatcggagacagattatgctcaggtcggctcaatg
aatggcttgagtttccggccctttgatttggttattccatttgccataaggacaggagag
ataacaggggacgttcacatgccttctgggaagaccgcccccgcagatatagttgacaac
aaagatggcactgtgtctattcgatacgttcccacagaaactggcctgcacgagttggcc
attaaatgtaatggagctcatatcccagaaagcccactgcagttctttgtgaattatcca
aacacaggaagtgtctctgcctatggcccaggcctaatatatggggtggctaataagcca
gccacattcaccattataaccgaggatgctggagaaggaggcctggatctggcaatagaa
gggccgtccaaggcagagatcagctgcatcgataacaaagatggcacttgcactgtaacg
tatctgcccaccctcccaggggattataacattcttgtgaaatataatgacacacacatc
gctggaagccctttcattgctaaaatcacagatgacagcaggcggcgctcacaagtgaaa
ctcggttccacagcagacttcctattggatatcactgagactgatctgagccttctgtct
gccagtatcaaagccccatctggtcgggatgagccctgtctactgaaaaggcttccaaac
aatcatattggaatctcctttatccctcgggaagttggggagcacttagtcagcattaag
aaaaatggccgccacatacccaacagtcctatatccatcatggtttaccagtcagaaata
ggggacgccagcaaggtgaaagcctttgggcctggtctgattgaagggcgaacgtatgag
atgtcggatttcattgtggacaccagagaggcaggctacggggggctgtcgctggcagtg
gaaggacccagtaaagtagacatccagacagaggacctagaggacggcacttgtcaggtc
tcctattgtccgacagaaccaggagtttacattgtgtccatcaagtttgcagatgagcac
gtgccaggaagcccattcacagccaaagtgatgggagagggaagagtgaaggagagcatc
acacgcaggaggaaggcaccatctgtggcctcagtgggtgggctttgtgagctcaacctg
aaaataccagaaattgacaggaatgaactcacagcagaggttgtcagcccatctgggagg
aaacaagaagcagagattgttgacctgggacagaacacgtcgtgtgtgcgttttgtgccg
caagagacagggatccacaccgtgagcgtaaaatacagaggggagcacgtgccggggagc
ccattccagttcactgtgggacccctgggagaaggtggagctgagaaagtgaaggctgga
ggccctgggttggaaagaggagaggctggagttccagctgaattcagcatatggacccgc
gaagctggtgccggaggcctctccattgctgtggaaggcccgagcaaagcagaaatttca
tttgaagaccggaaagatggctcttctggggtgtcctatgtagtacaagagcccggtgac
tacgacgtgatcatcaagttcaacgatgaacatattccccagagcccgttcctagttccc
atcgttgccacgtcggacgatgcccgccggctcactgtcaccagccttcaggagtctgga
ttaaaggttaatcagccagcatcctttgccatacggcttaatggcgccaggggcaagatt
gatgccaaggtgcacagtccgtctggggcagtggaggaatgctttgtgactgaactggaa
ccagataagtacgccgtacgctttatgccacgggagaacgggatccacatgattgatgtc
aagtttaatgggagccacgttccagggagtccatttaaggtgcgagttggcgaggcggga
caggaaggagacccaggcctagttacagcctacggagacggactggagaccggtaccacg
ggcaaacaatcggagtttatcattaatacaagcaaagccggaccaggggccctgtcagtg
acaattgaggggccgtccaaggtaacgatggagtgcaaggaatgcccagaaggatacaga
gttctctacacgccaatggcgccaggaatttacatgataggagtgaaatacggcgggccc
aaccacattgtcggcagccctttcaaggccaaggtcacaggtcagcgccttgtgggtatt
gggggtaccagcgagacctcctctatcatcgtccagtctgtgacccgggcttccaccgag
accacctacagcgctttgccgagatttgcatcagacgccaccaaagtgacatccaaaggg
gccggcctgtctaaagctttcctggggcagaagagcacttttaccgtggattgcagtaaa
gcaggttccaacatcctattggtgggtgtccatggccccaccctcccctgcgaggaggtc
tctatcaagcacctggggaacaagcactacactgtccattaccacgtgaaggagagaggg
gattacatgctggtagtaaagtggggcgaggagcacattccggggagccccttccacatc
accgtcccgtaa

DBGET integrated database retrieval system