KEGG   Xenopus tropicalis (western clawed frog): 100485165Help
Entry
100485165         CDS       T01011                                 

Gene name
flnb
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100485165 (flnb)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100485165 (flnb)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100485165 (flnb)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100485165 (flnb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2603 aa AA seqDB search
MPVTEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFSQMQLENVSVALEFLERENIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPVWEDEGDEETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAP
GLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNR
EEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAK
GPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYK
PIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVRIRETADFRVDT
KAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPF
EVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQ
GDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTG
CIVSTPAEFAVDPTDAGKAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVA
VTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSV
GIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRIKV
DPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGDAVKDFEII
DNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVEVG
KDQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVS
YDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG
PCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIAT
GPGLEHGKVGEAGLIHVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFA
GMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLT
KTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFK
VGVTEGCYPDRVKAQGAGLTEALTNKPNLFSVITRGAGIGGLGITVEGPSESKMSCKDNK
DGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGLGTAVRAKI
PQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYAD
EEIPRSPFKVKVLPTYDASKVTASGPGLCAQGISASLPVNFAVDAKNAGLGPLSVQITDQ
EGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRAMSIGDASKCTV
AGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYYTTA
KTGPYVIHVRFGGADIPNSPFTVMATDEVPVQVQQQSLSACPPGYQPLVSETDYAQVGSM
NGLSFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELA
IKCNGAHIPESPLQFFVNYPNTGSVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIE
GPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSRRRSQVK
LGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIK
KNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAV
EGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMGEGRVKESI
TRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVP
QETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPFLVP
IVATSDDARRLTVTSLQESGLKVNQPASFAIRLNGARGKIDAKVHSPSGAVEECFVTELE
PDKYAVRFMPRENGIHMIDVKFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTT
GKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIGVKYGGP
NHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETTYSALPRFASDATKVTSKG
AGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERG
DYMLVVKWGEEHIPGSPFHITVP
NT seq 7812 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgacggagaaggacctggcccaggacgcgccatggaagaagatccagcagaac
accttcacccgctggtgcaacgagcacctcaagtgcgtcaataagcgcatcggcaacctg
cagaccgacctgagcgacgggctgcgactgatcgcgctgctggaggtgctcagtcagaaa
aggatgtaccgcaagtaccaccagagacccaccttcagccagatgcagctggagaacgtt
tcggtggccctggagttcctggagagggagaacatcaagctggtgtctatagacagcaaa
gctattgtggacggcaacctaaagcttatcctcggcctgatatggacccttatcctgcat
tattccatctccatgcccgtttgggaagatgaaggtgatgaggaaaccaagaaccagacg
ccaaagcagagacttctgggctggatccagaacaaaatccctcagctgccaatcaccaat
ttcagccagaactggcaggatggaaaggcactgggagctctggtggatagctgtgcccca
ggattatgtcccgattgggaatcttgggaccctaagaagccggtggagaatgccagggag
gctatgcagcaagctgatgattggctaggagtccctcaggtgattgctccagaagaaatc
attgatccgaatgtggatgaacactctgtaatgacctacctgtcacagttccctaaagcc
aaattaaagcccggggcacccttgaagcccaaactgaacccgaagaaagccagagcttat
ggattaggtgttgaaccaactggtaatatggtgaaaagatcagcaccgtttactgtggag
accatcagtgcagggacaggcgaggttctggtgtacatagaagatccagaaggcaacagg
gaagaggccaaggtcacaggaaacaatgacaagaacaaaacattttcagtggagtatgtc
cctaaagttacaggcatgcataaggtcacggttctgttcgccgggcaacatattgcaaag
agtccatttgaggtcaacgtcgagaaggctcagggagatgccagcaaggtgaccgccaaa
gggcccggcttggagcctatcggaaacattgccaataagccgacgtattttgacatttat
acagcaggggcgggagtaggggacattggcatcgaagtgatcgacccccagggcaggaac
aacacagtggaactggccctcgaggataaaggcaattgtgtctaccgatgtacatacaag
cccattaaagccggacctcacaacgtcgccatcaactttggaggtgaagccacaccaaaa
agcccttacctggtcagcattggtgaagcctgcaaccccaatgcctgccgagccaacgga
cgtggcctgcagcccaaaggcgtcagaatccgagaaactgctgattttagggtcgacacg
aaagctgcaggaagtggcgaccttcatgtttctgtcaaagggccaaagggcttggacgag
gtgctgaaacagtcggaatccctggatggactccatttatttgagtactatcccctgact
cccgggaagtatgtggtcgcaatcacgtggggcggccatcacatcccaaagagtccattt
gaggtccaggtggctctggaagctgggccccaaaaggtacgcgcttggggtcctggactg
tatagtggaatggctggaaaggctgcagactttgtggtggaatctgttggctccgaggtt
ggctccttaggttttgccatagaaggtccctctcaagccaaaatcgaatgcgaagaccaa
ggcgatgggtcatgtgacgtcagatactggccaaaggagccgggggaatatgccattcac
atcatgtgtgacgatgaggacattcagaatagcccgtacatggccttgatccagcccgcg
tccggagacatagatcctgataaggtgaaagcttatggcccagggctggagaaaactggc
tgcattgttagtacccctgctgagtttgctgtagatccaacggatgctggaaaagcagca
ttaaagatctattcccaggatgtggaagggaatccagtagatatcatgaccaaagagaag
ccagatggtacctacgcctgctcatacacacctgccaagccaatcaaacacacagtggct
gtcacgtggggcggagtcagcgtgcctaacagtccatttagggtcaatattggacaaggc
agccacccacatttggttaaggtttttggccccggtgtggagaaaactggtttgaaagca
aatgagccgactcactttacagttgactgcaccgaggcaggagaaggtgatgtgagcgtc
gggattaaatgtgacgcgcgcgtgatcagcgatgaggaggaagatattgactttgatatt
attcccaacgctaacgacacctttaccgtgaaatatatgccaccggctgccgggcgttat
accattaaagtgctcttcgccggagaagaaattcctgaaagtccctttagaatcaaagtc
gatccctcgcacgatgccagcaaagtgagggccgaggggccaggactgagtaaatctggt
gttgaaaacgggaaaccctcacactttaccgtctataccaaaggcgcagggaaggcgccg
gttgatgtttcctttactggacctgccccaggggatgcagtgaaagactttgagatcata
gacaactacgattactcacacaccgtccgatacactcccgtacagcagggcaaaatgaaa
gtggctgtaaattatggcggcgaccctatccccaagagtcccttcaccgtaggtgtggca
gcaccactggacctgaacaagatcagaataaatggcctggaaagtagagtggaagttggt
aaagatcagcagtttattgtggaccctaatggagctggtggacaaggaaaactggaggtg
aagatctccagcccgagtcggaaatcagtcccgtgtttggtggaacctgttcctggtaat
gagtgcagcactgtcaaatatattcccaaagaggagggtctctacaacgtggatgtgagt
tatgatgggaatccagttcctggaagtccatatgtagtggaagccactttgcctccagat
ccttcaaaggttaaggcctatggaccaggtctggaaggaggtcttgttggaaagcctgct
gaatttaccattgatacaaaaggagccggaactggtggcttgggtctgaccgtcgaaggt
ccttgtgaagccaagattgaatgttctgacaatggtgatggcacatgttctgtctcctac
cttcctactacaccaggagaatattttgttaatattctttttgaggaaacccacattccg
gggtcaccttttcaagcgaacgtggaaatgccctttgatccttccaaagtaattgccaca
ggtccaggccttgagcatggcaaagtaggagaagcgggcttaattcacgtggactgttcc
caagcaggaccaggtaacctggcagtagaggctgtctctgattctgggtcaaaggcggaa
gtcaacgtacaggataacaaggatgggacttacacggtcacctatgtgccactttttgct
ggcatgtatacactagcactgaaatatggtggagaacaagtgccaaagtttcctgcccga
gttaaagttgatccagccgtggataccagtaagatcaaagtgtttggaccaggaatagaa
gaaaaaggagtttttagagaagctacaaccgactttaccgtggatgccaaatcactaacc
aaaaccgggggcaatcacgtcaaaaccaaaattaccaatccatccggagcgtccaccgat
taccttcttagagacaatggagatggcacttactacgtagagtacactccttttgaaaaa
ggcgctcatgcaattaaggtgacctacgatgacgaaccggtccccaacagcccattcaaa
gtgggagtgacagagggctgctaccctgatcgcgtgaaagcccaaggtgctggactcaca
gaggctttgacaaacaagccaaatttgttttcagtcattacaaggggggctgggattggc
ggcctaggaattacagtggaaggaccctcagaatccaaaatgtcttgtaaagacaacaag
gatggcagctgcagtgtggaatacactccctatgtcacaggggactatgatgtgaatatt
acatatgatggagagcatattccaggcagcccattcagagtaccagtgaaagatgttgtg
gatcccagcaaggtcaagatatctggccctgggctgggaacagcggtacgagcaaaaatc
cctcagcagtttacagtagataccagcaaagctggcattgcgcccctggcagtgcaagtg
acaggaccaagagggacggtggaaccggtagacctggtggataatggagacgggactcac
acagtcagttacacgcccacgctggagggcccctacaccgtagctgttcagtatgcagat
gaagagatcccgcgaagtccctttaaggtaaaggtcttgccaacgtacgatgccagcaag
gtgactgccagtggtcctggcctctgcgctcaaggaatttccgccagcctcccagttaat
tttgctgtagatgccaagaatgccggactgggacccctgtcggtccaaatcacggatcaa
gaagggaagccaaagaaagcgcagattcaggacaacaacgatggcacctattctgtgtct
tacatcccggacaggactgggcgataccacgttgctgtcaaatatggaggagatgacatc
ccttactccccgtacagaatccgcgccatgtccataggagatgccagcaagtgcactgta
gcaggtcctggtatccaggcagcagtaaaaactggcgaagaggttggttttgtagtagat
gccacaactgccggcaaagggaaagtcacgtgcagcatccttggcccagatggtttggag
aatgaagcagatgtgattgagaatgtggacggcacttatgacatttactacactacagct
aaaacgggaccgtacgtcatccatgttcgctttggcggagccgacatccccaatagcccc
ttcactgtgatggctacagatgaagtccccgtacaggtgcagcagcagtcccttagtgca
tgtcctccaggctaccagcccttggtatcggagacagattatgctcaggtcggctcaatg
aatggcttgagtttccggccctttgatttggttattccatttgccataaggacaggagag
ataacaggggacgttcacatgccttctgggaagaccgcccccgcagatatagttgacaac
aaagatggcactgtgtctattcgatacgttcccacagaaactggcctgcacgagttggcc
attaaatgtaatggagctcatatcccagaaagcccactgcagttctttgtgaattatcca
aacacaggaagtgtctctgcctatggcccaggcctaatatatggggtggctaataagcca
gccacattcaccattataaccgaggatgctggagaaggaggcctggatctggcaatagaa
gggccgtccaaggcagagatcagctgcatcgataacaaagatggcacttgcactgtaacg
tatctgcccaccctcccaggggattataacattcttgtgaaatataatgacacacacatc
gctggaagccctttcattgctaaaatcacagatgacagcaggcggcgctcacaagtgaaa
ctcggttccacagcagacttcctattggatatcactgagactgatctgagccttctgtct
gccagtatcaaagccccatctggtcgggatgagccctgtctactgaaaaggcttccaaac
aatcatattggaatctcctttatccctcgggaagttggggagcacttagtcagcattaag
aaaaatggccgccacatacccaacagtcctatatccatcatggtttaccagtcagaaata
ggggacgccagcaaggtgaaagcctttgggcctggtctgattgaagggcgaacgtatgag
atgtcggatttcattgtggacaccagagaggcaggctacggggggctgtcgctggcagtg
gaaggacccagtaaagtagacatccagacagaggacctagaggacggcacttgtcaggtc
tcctattgtccgacagaaccaggagtttacattgtgtccatcaagtttgcagatgagcac
gtgccaggaagcccattcacagccaaagtgatgggagagggaagagtgaaggagagcatc
acacgcaggaggaaggcaccatctgtggcctcagtgggtgggctttgtgagctcaacctg
aaaataccagaaattgacaggaatgaactcacagcagaggttgtcagcccatctgggagg
aaacaagaagcagagattgttgacctgggacagaacacgtcgtgtgtgcgttttgtgccg
caagagacagggatccacaccgtgagcgtaaaatacagaggggagcacgtgccggggagc
ccattccagttcactgtgggacccctgggagaaggtggagctgagaaagtgaaggctgga
ggccctgggttggaaagaggagaggctggagttccagctgaattcagcatatggacccgc
gaagctggtgccggaggcctctccattgctgtggaaggcccgagcaaagcagaaatttca
tttgaagaccggaaagatggctcttctggggtgtcctatgtagtacaagagcccggtgac
tacgacgtgatcatcaagttcaacgatgaacatattccccagagcccgttcctagttccc
atcgttgccacgtcggacgatgcccgccggctcactgtcaccagccttcaggagtctgga
ttaaaggttaatcagccagcatcctttgccatacggcttaatggcgccaggggcaagatt
gatgccaaggtgcacagtccgtctggggcagtggaggaatgctttgtgactgaactggaa
ccagataagtacgccgtacgctttatgccacgggagaacgggatccacatgattgatgtc
aagtttaatgggagccacgttccagggagtccatttaaggtgcgagttggcgaggcggga
caggaaggagacccaggcctagttacagcctacggagacggactggagaccggtaccacg
ggcaaacaatcggagtttatcattaatacaagcaaagccggaccaggggccctgtcagtg
acaattgaggggccgtccaaggtaacgatggagtgcaaggaatgcccagaaggatacaga
gttctctacacgccaatggcgccaggaatttacatgataggagtgaaatacggcgggccc
aaccacattgtcggcagccctttcaaggccaaggtcacaggtcagcgccttgtgggtatt
gggggtaccagcgagacctcctctatcatcgtccagtctgtgacccgggcttccaccgag
accacctacagcgctttgccgagatttgcatcagacgccaccaaagtgacatccaaaggg
gccggcctgtctaaagctttcctggggcagaagagcacttttaccgtggattgcagtaaa
gcaggttccaacatcctattggtgggtgtccatggccccaccctcccctgcgaggaggtc
tctatcaagcacctggggaacaagcactacactgtccattaccacgtgaaggagagaggg
gattacatgctggtagtaaagtggggcgaggagcacattccggggagccccttccacatc
accgtcccgtaa

DBGET integrated database retrieval system