KEGG   Xenopus tropicalis (western clawed frog): 100485467Help
Entry
100485467         CDS       T01011                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xtr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 439 aa AA seqDB search
MVKLWVLLLLGTLSESVTFPEQEKDPKYWRRQAQDTLRDALLLLQNLNTNVAKNVIMFLG
DGMGVPTVTATRILKGQMAGQPGEETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAYLC
GVKANEGTVGVNAAAVRGQCNTTRGNEVDSILKWAKQAGKSVGVVTTTRINHATPSAAYA
HCVNRDWYSDLEMPKEAVEQGCKDIAWQLMHNVPNIEVIMGGGRKYMYPRNTSDVEYPND
DKASGTRLDGLNLTQIWLDQKPNKQAARYVWNRQQLLSVNPQEVDHLLGLFEPIDMLYEL
ERNTTMDPSLPEMVEMAIKILRKNPEGFFLLVEGGRIDHGHHEGKANQALHEAVQMDIAI
GLAGSMTSEEDTLTVVTADHSHVFTFGGYTHRGTSIFGLAPAVSDVDQKPFTSILYGNGP
GYKLVNGQRENVSTVDFCE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactgtgggtgctgctcctgctggggaccctctctgagtctgtcacgttccca
gaacaagagaaggacccaaagtactggcggcgccaggcccaagacacactgagggatgcg
ctgctgctgctgcagaacctcaacaccaacgtggcaaagaacgtcatcatgttcctgggt
gatggtatgggggtgcccacagtaacagccacgcggattctcaaagggcaaatggccggg
cagcccggggaagagacacagcttgaaatggacaagtttccccacgtggctctctccaag
acctacaacaccaacgcacaggtgccagacagcgcgggcactgccactgcctatctatgt
ggggtgaaagccaacgagggcacagtgggagtcaatgcagccgcagtgcggggccagtgt
aacaccacccggggcaacgaggtggactccatcctgaaatgggccaagcaagcagggaaa
tccgtaggggtagtaaccacaacgcggattaatcatgccacccccagcgccgcctatgcc
cactgcgtgaacagagactggtactcggacctggagatgcccaaggaggcggtggaacag
ggctgtaaggacatcgcctggcaactcatgcacaatgtcccgaatattgaggtaattatg
ggagggggcaggaagtacatgtaccccagaaacacctcggacgtggagtaccccaatgat
gacaaggcgagcggcactcgattggacggactaaacctgacccaaatctggctggaccaa
aaacccaataaacaggcggcccgatatgtctggaaccggcaacagctactgtctgtcaat
ccgcaggaagtggatcatctgcttggactctttgagccaatagacatgctgtatgagttg
gagagaaatacgaccatggacccatctttgcctgaaatggtggaaatggcaatcaaaata
ttgaggaaaaacccagagggatttttcctccttgtagaagggggaagaatagaccacgga
caccacgaggggaaggcaaaccaagcgctgcacgaggcggtacagatggacatcgctatt
gggctggcggggagcatgacatccgaagaggacaccctaacagtggtcaccgccgaccac
tcccacgtcttcaccttcgggggttacacccaccggggaacctccatctttggtttggct
ccggctgtgagcgacgtggaccagaagcccttcacctccatcctgtatgggaacggcccg
ggctacaaactggtgaatgggcaacgggagaacgtctccactgtggatttctgtgagtag

DBGET integrated database retrieval system