KEGG   Xenopus tropicalis (western clawed frog): 100485566Help
Entry
100485566         CDS       T01011                                 

Gene name
lamb2
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:xtr04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1783 aa AA seqDB search
MAPSLWPFGIVITALVTGSLSQIPDQQHGCSQGSCYPATGDLLVGRADKLKATSTCGLRR
AQPYCIVSHLQDEKKCFVCDSRKPYNPLYNPISHRIENVITTFAPHRKKAWWQSENGVSA
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWQAYRYFGHDCASSFPNVSRS
ALRKVDEVICESRYSDIEPSTEGEVIYRVLDPAIPIRDPYGPNIQNLLKITNLRINFTKL
HTLGDNLLDSRVEIKEKYYYALYELVVRGNCFCYGHASECAPIQGVSRDVEGMVHGRCVC
KHNTKGLNCEQCDSSFNDLPWRPAEGRSTNACKKCNCNNHSRKCHFDMAVYLSTGNVSGG
VCDDCVHNTMGRNCELCKPFFYKDPSKDLRDSAVCKACDCDPDGSLDGGLCDSLDNPALG
LIAGQCRCKDYVEGPRCDRCKTGFFGLSTNNFQGCQRCQCDPRGTISDGAQCDPISGDCF
CKRFVTGRTCNQCLPEFWALSHDLHGCRSCDCDIGGAWDNHCATETGQCRCRSHMVGRQC
NQVKSGYYRIHLDHYTYEAESALHRQGCSVLERERLIGRPATWTGPGFALVPEGGILEFQ
ISNIPYSMEYDVIIRYEPQLPATWEQVKISVIRPGPIPTSSPCGNTIPADDLMVASLPPG
TRHVVLPQPVCLERGVSYTIRLEFSRYSLREKIPSANILIDSLVLVPRYSSMEMFIAGDP
ASIQRKETFERYRCHSNSGNVIKSSTTEVCSGLITSMSAIIHEGALPCSCDPQGSLSSEC
DPNGGQCQCKANVIGQRCDRCAPGTHGFGPTGCKACECNMEGSTHNFCDQRTGQCPCRPG
AFGSRCDRCQPGHWGFPNCRQCQCNGHSEECDQRTGACLNCRDHSTGDRCERCTAGFYGN
PILGSGDHCRPCPCPEGPNSGRHYAASCHQDPRSRQVICNCKQGYTGPRCEECSPGFFGN
PFQTGGRCLLCQCNNNIDMTDIGGCDRRSGQCLKCKYNTEGRFCEHCRIGFYGDASRRNC
RKCTCNYLGTEPSQCPSREDCMCDRTSGQCLCLPNVRGQNCDRCSPHFWNLASGKGCQPC
NCDPNHSFSLSCNEFTGKCQCRPGFGGLTCTDCQENYWGNPNIQCRACDCDRRGIKAPQC
NRASGHCDCRAGVSGVRCDQCARGFSGQFPDCQPCHQCFGDWDRIVQDLATRTKSLVQRG
KDIQQSGVAGVYQKNFREIEKKLAKAQGIVNARNATAESVTKLMKIMDDLRNKINESTEA
LTQLEGELTAVQDENFDANHDLAELERDARSLNMTAKERSHQLDVLKNSNFLGAYDSIQQ
SHAKSRQAEKQANNATTNVPSPVSDSARTREKTQQLITHKRDDFNRKNAANRRALNDLAA
KTDTLDMKKINEKVCGAPGDAPCSESPCGGAGCRDDEGKRHCGGLNCNGAVATADNALGR
ARHAEEELQKALGEVEVLFQKVAEAKVKADRAKQRAQATLDRANETKARVEQSNKELREL
IQQIKDFLNQEGADPDSIEMVASRVLDLTIPATPKQIQRLAEEIKDRVKTLANVDAILDQ
TAADVRKAEQLLHEAKRAKNRAENVKNTAESVKRALDDARRAQNAAEGAIQSANDDIKDT
ERKLTAIQTATSSAENQLNDAMDRVGNLDKQIDGLKMKRANNSLAASRAEESATAALDKA
NDAKKILEGQLADKYKTVQNVVDRKAKNIKEAKTKADQLQDEAKKLLENAQDKLKRLQDL
EVEYTKNEKLLQDKAKRLNGLEDKMKEILHAINQQIQIYNTCQ
NT seq 5352 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtccttgtggccatttggcattgtgataactgccttggtcacaggatccctt
tcccagattcctgaccagcaacatggatgttctcaaggtagctgctaccctgccactgga
gacttgctggtgggccgagccgataagctcaaagctacatctacctgtggccttcggaga
gctcagccatactgtatagtcagccatttgcaggatgaaaagaaatgcttcgtctgcgac
tctcgcaagccctacaatcccctgtataaccccatcagccaccgcattgaaaacgttatt
acaacctttgctcctcatcgaaaaaaggcttggtggcagtctgaaaatggtgtttccgca
gtcactattcagctagatttggaggctgaatttcacttcacccacctgatcatgaccttc
aagaccttcaggccggcggccatgctggtggaacgctctgcagactttggccgtacctgg
caggcttaccgttactttggacacgactgtgcctcctccttcccaaacgtgtcccgcagt
gccctgaggaaggtggatgaagttatctgtgaatcccgttactctgacattgagccctct
acggaaggggaggtcatttacagagttttggatccagctatcccgatccgagacccatat
ggcccaaatattcagaatctcttgaagatcaccaacctcagaatcaactttaccaagctg
cacacattgggcgacaaccttctggattcccgagtggagatcaaagagaagtattactat
gccctttacgagctggtggtacgagggaactgcttctgttatggccatgcatctgaatgc
gcgcccatccaaggagtgtccagagatgtcgagggcatggtgcatggaagatgtgtgtgc
aaacacaataccaaggggctcaattgtgagcaatgtgatagttcctttaatgatcttcct
tggagaccagcagaaggacgcagcaccaacgcctgtaaaaagtgcaactgcaacaatcac
tctcgcaagtgtcactttgacatggccgtgtacttgtctactggaaatgtgagcggtggg
gtatgtgacgactgtgtgcacaacaccatgggccgtaactgtgaactgtgcaagccgttc
ttctacaaggatccaagcaaggatttacgggacagtgcagtctgcaaagcctgtgactgt
gacccagacgggtcgttggacggaggcctgtgtgactccctggataacccagctttgggt
ctcattgctggacagtgccgctgcaaagattatgtcgaaggcccaagatgtgatcgatgc
aagactggattctttggcctgagtacaaataactttcagggctgccaaaggtgccagtgt
gacccaagaggtaccatctcggacggtgctcagtgtgacccaatcagtggcgactgtttc
tgcaaacgctttgtgactggccgaacatgcaaccaatgcctgcctgaattttgggccctc
agccatgacctccatgggtgcagatcctgtgactgtgacattggcggtgcctgggataac
cactgtgctacggagacaggccagtgtcgatgccgcagccatatggttggcaggcaatgt
aaccaggtgaaatctggctactaccgcatacacctggatcactacacgtacgaggccgaa
tctgctttgcaccgacagggttgttcagtgttggagagggaacgtctgatcggtcgccca
gccacatggactggtcctggatttgccctggtcccagagggaggaattctagagttccag
atcagcaatattccttattctatggaatatgatgtcatcatacgttatgaaccccagctt
ccagcaacttgggaacaagtcaaaatatccgtgattagaccgggtcctatcccaacgagt
agcccatgtggtaataccatcccagctgatgatctgatggtggcatctctaccccctggc
acaaggcatgtagtcctgcctcagccggtttgtctggaacgtggggtcagttatactatt
cgactggagttcagcagatacagtttgagagaaaagatacctagtgccaacatattgatt
gattcgctagtgctggttcctagatactcctccatggaaatgttcattgccggagaccct
gcatctatacaacgcaaggagacttttgagcgttatcgctgccatagcaacagtggaaat
gtaataaagtcatctaccaccgaggtgtgctctggtctcatcacaagcatgtcggctata
attcatgaaggagcactgccctgtagctgtgacccacagggatctctgagctcagaatgt
gaccccaatggtgggcagtgccagtgtaaagctaatgtcattgggcagcgctgtgatcgc
tgtgcaccaggaacacatggatttggaccaacaggatgcaaagcctgtgaatgtaatatg
gagggatccactcacaatttctgtgatcagcgcaccggtcagtgtccttgtcggccaggg
gcatttggctccaggtgcgaccgctgccagcctggccactggggcttcccaaactgccgg
cagtgtcagtgcaatggtcattcagaagagtgcgaccagagaacaggggcatgtctgaac
tgccgagaccacagcaccggagacagatgtgagagatgcactgcaggcttttatggaaac
ccaattctgggctcaggggaccactgccgtccctgcccctgccctgaggggcccaacagt
gggcgacactatgcagcatcctgtcatcaagacccccgttccagacaagtcatctgcaac
tgcaaacaggggtacacggggcctcgctgtgaagaatgttctccagggttctttggaaat
ccattccagactgggggacgctgccttctttgccagtgtaataataacattgatatgaca
gatattgggggttgtgaccgccgcagtggccagtgcctcaaatgcaagtacaacaccgaa
gggaggttctgtgagcactgtcgaattggcttttatggggatgcatcaaggcgcaactgc
agaaaatgtacatgtaactaccttgggacagaaccaagccagtgtccatcacgggaagac
tgcatgtgtgacagaacaagcggacagtgcctttgcttaccaaacgtcaggggtcagaac
tgcgaccgttgcagtccacacttttggaacctggcaagcggcaagggctgtcagccatgt
aactgtgaccccaaccattccttcagcctatcctgcaatgagtttacaggaaaatgtcaa
tgccggcctggattcggtggcctgacctgtacggattgccaggaaaattattggggaaat
cccaatattcaatgcagggcttgtgattgtgatcgccgtggcatcaaggcaccacagtgt
aatagagcctcgggtcattgtgactgccgggctggagtgtcaggagtgcgttgtgaccag
tgtgcccggggattttctgggcagtttcctgattgccagccctgtcatcagtgttttggt
gactgggaccgtatagttcaagacctggccactcgtaccaagagcctagttcaaaggggc
aaggacatccagcagagtggggtagccggagtgtaccaaaagaacttccgtgagatcgag
aagaagcttgccaaggctcaaggcattgtcaatgcccgcaatgccactgcggaatcagtg
actaaactaatgaagattatggatgacttgcggaataaaattaacgagtcaacagaggct
ctcacgcagttagagggcgaactgacagctgtgcaggatgagaactttgatgccaaccat
gatctggccgagttggaaagggatgctaggagtttaaacatgactgccaaggagaggtcc
catcagctggatgtcttgaagaactcaaactttttgggtgcatatgacagcatccaacaa
tctcatgcaaagtcaagacaagccgaaaaacaagccaataatgccaccaccaatgttccc
agtcctgttagtgactcagctaggaccagggagaagacccagcagctgataacacacaag
cgggatgactttaataggaagaatgcagctaatcgtcgggcacttaatgatctggcagct
aaaacagacacccttgacatgaaaaagatcaatgagaaggtctgtggggctccaggagat
gccccatgctctgagagtccctgcggtggagctggttgtcgtgatgatgaagggaagagg
cactgtggtgggttgaactgtaatggagccgtggctactgctgacaatgctttgggacga
gcacgccatgctgaagaagaacttcagaaagcactaggagaagtagaagtgcttttccaa
aaggtggctgaagcaaaggtaaaggcagacagagcaaaacagagggcacaagccaccctc
gacagggcaaatgaaacaaaggcaagggtggaacagtccaataaggagctgcgggaactc
atccagcaaatcaaggactttctgaaccaggaaggtgcagacccagacagcattgagatg
gtggcaagtcgtgtcttggatctcacaatccctgcaaccccaaagcaaatccagcgtctt
gctgaggaaatcaaggacagagtgaaaacacttgcaaacgtggatgccattctggaccaa
accgctgctgatgtgcgcaaagcagagcaactgctgcatgaagccaaaagagccaagaac
cgagccgagaatgtaaagaacacagccgagtctgtgaaaagggccctggatgatgctagg
agagctcagaatgctgctgaaggagctatccaaagcgccaatgatgacatcaaagacacg
gagaggaaattaacagcaattcagacagcaacatctagtgcagagaatcagcttaatgat
gctatggatcgagtaggaaatctggataaacaaattgacggtctgaaaatgaaaagggcc
aacaacagcttggctgccagccgtgcagaagaatctgccactgcagcactggataaagca
aatgatgccaagaagatcttagaaggacaactggcagacaaatacaaaactgttcagaat
gttgttgatcgaaaagctaagaacattaaagaggcgaagacaaaagcggaccaacttcaa
gatgaggcaaagaaactcttagagaatgcacaggataaattaaagaggttgcaagatctg
gaagttgaatatacgaagaacgagaaacttcttcaggacaaagcgaaacgtcttaatggc
ctagaagacaagatgaaggaaattttacacgcaattaaccaacaaattcagatttataac
acctgccagtag

DBGET integrated database retrieval system