KEGG   Xenopus tropicalis (western clawed frog): 100485678Help
Entry
100485678         CDS       T01011                                 

Gene name
bdh2
Definition
3-hydroxybutyrate dehydrogenase, type 2
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100485678 (bdh2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100485678 (bdh2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100485678 (bdh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 245 aa AA seqDB search
MGRLDGKVIVLSAAAQGIGRAAAIAFVNEGAQVIATDINETKLKELEAYKGIQTRVLDVT
KKDQIEKLCKEIDRVDVLFNVAGFVHHGTILDCAEADWDFTMNVNVRSMYLMIKTFLPKM
LAQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVASDFIEQGIRCNCICPGTV
DTPSLRERIQARPDPEQAFKDFLARQRTGRMATAEEVAHLCVYLASDESAYVTGNEHIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtttggatggaaaagtgattgttctgtcagctgcagcacaaggcattggaagg
gctgcggccattgcatttgtcaatgaaggagctcaggtcattgcaacagacatcaatgaa
acaaagctaaaagaactggaagcttataaaggtattcagacaagagttttggatgtcact
aaaaaggatcagattgaaaaattatgcaaagaaattgatagagtcgatgttctcttcaat
gtagctgggtttgtgcaccatggaactatattggattgtgcggaggcagactgggatttc
accatgaatgtaaatgtccgtagcatgtaccttatgattaaaacattcttgcccaaaatg
cttgctcagaaatcaggaaatattattaacatgtcttctgtggcatcaagcattaaaggt
gtggtgaacaggtgtgtgtacagtacatcaaaggcagcagtcattggcctgaccaaatcg
gttgcgtcagacttcattgagcaaggcatcagatgtaactgtatttgtcctgggacggtg
gatactccatctttaagggaaaggattcaagcaaggccagatcctgaacaggcttttaag
gactttcttgcacgacaaaggactggcagaatggctactgcagaagaagttgcccatctt
tgtgtgtacctggcatctgatgaatctgcatatgtcactggtaatgagcacattattgat
ggaggttggagtctgtga

DBGET integrated database retrieval system