KEGG   Xenopus tropicalis (western clawed frog): 100485811Help
Entry
100485811         CDS       T01011                                 

Gene name
adra2b
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100485811 (adra2b)
G protein-coupled receptors [BR:xtr04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [Table]
    100485811 (adra2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 410 aa AA seqDB search
MVAPLSYSIQATAVIAAIITFLVLFTIFGNVLVIIAVLTSRSLKAPQNLFLVSLAAADIL
VATLIIPFSLANELMGYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEY
NSKRTPKRIKCIILIVWTLAALISLPPLIYKGKSKDQNAKPECKLNEEPWYILSSSICSF
FAPCLIMILVYLRIYLIAKRRNRKNSTDKKLKKMAPGLFSRTNKHSLNSSHTQTQCGIIS
SQEKTGLALDDLHCGVPVLSSTREERNGHSESFGLQPQGENLKHTNGCEPAVMDTVATVK
GVMLMPKGAKDSDLSSAKKKSYINREKRFTFVLAVVIGVFVLCWFPFFFTYSLGAICTEL
CYIPDSVFQFFFWIGYCNSSLNPVIYTIFNQDFRKAFRRILCSHWSQTTW
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggttgctcccctttcatactccatccaggctacagctgtcatagcagccatcatcacc
tttcttgttctcttcaccatttttggaaatgtgttggtcatcattgctgtgctaacgagc
cggtctttgaaagctcctcagaacttatttttagtctctctggctgcggcagatatttta
gtagccactctgataatacccttctccttggccaatgagttaatgggatactggtatttc
ggcaagacctggtgtgagatgtatttggccttggatgttttattctgcacctcctccatt
gtgcacctatgtgccatcagtctggacaggtactggtcagtaagccaagctatagagtat
aattccaagaggactccaaaaaggatcaaatgcatcatactcattgtttggacacttgca
gccttgatctctctgccaccattaatttataaaggtaaaagcaaagaccaaaatgctaaa
cctgaatgcaaattgaatgaagaaccctggtatatactttcttctagcatctgttccttc
tttgcaccttgccttattatgatcctggtgtatctaagaatctatctcattgccaaacgc
aggaatagaaagaacagtacagacaaaaaacttaagaaaatggcgcctggactcttcagc
cgtacgaataaacatagtttgaacagttcacatacacaaactcaatgtggtattatatct
tcacaggaaaaaacagggttagcattggatgatctccactgtggtgtcccagtgttgtct
tcaacacgtgaggaacgcaatggccactcagagtcgtttggtcttcagccccaaggggag
aacctaaaacacaccaatggttgtgagcctgcagtgatggacactgttgccactgtcaaa
ggtgtgatgctgatgccaaaaggggctaaagattctgatttaagttcggccaagaagaaa
agttacattaacagagaaaaaagattcacctttgtactggctgtggttatcggggtcttc
gtcttgtgctggttcccattctttttcacctacagccttggagccatctgcactgagctc
tgttacattccagacagtgtctttcagtttttcttctggatcggatactgtaatagctcc
cttaaccctgttatatacaccattttcaaccaggacttcagaaaggctttccgaaggatt
ctgtgcagccactggtcacagacaacatggtga

DBGET integrated database retrieval system