KEGG   Xenopus tropicalis (western clawed frog): 100486264Help
Entry
100486264         CDS       T01011                                 

Gene name
acss2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:xtr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xtr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:xtr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:xtr00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 692 aa AA seqDB search
MSSPGVFPPAPEVSAAAHIPSYARYQELYERSIRHPDEFWGEIANEFHWRVPPAQPFLRY
NFDVTKGKIFIEWMKGGVTNICYNVLDRNVQDKKLGDKIAFYWEGNEPGDSMSITYSELL
RKVCQFANVLRGQGIKKGDRVSIYMPMVIELVVAMLACARIGAIHSIVFAGFSSESLCER
ILDSNCTLLITADGFFRGDKLINLKSIADEALKKCAEKNYPLSKCIVLKHLGRDEIVSDG
PSKISPPCKRQCPDLQGKKQEKPKRSHPQINWKPSVDMWWHELIKDASVECEPEWCDSED
ELFILYTSGSTGKPKGVVHTVGGYMIYTATTFKYVFDYHPDDVYWCTADIGWITGHSYLT
YGPLANGATSVLFEGLPIYPDISRMWQIIDKYNVSKFYTAPTAIRLLMKYGEEPVKRYSR
KSLKVLGTVGEPINPEAWLWYYNVVGDKRCPIVDTFWQTETGGHVLTPLPGATTAKPGSA
TFPFFGVVPAILDESGEELEGEAEGYLVFKQPWPALMRTVYGNQERFETTYFKKFPGYYV
TGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHSSIAEAAVVSHPHPVKGE
CLYCFVTLRDGHEFTSTLVDQLKKLVREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRK
IAKNDRDLGDISTLADSTVIQQLFENRCKTVQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccctggggttttccctcctgccccggaggtctcagctgctgcccacatccca
tcatatgcgagataccaggagctgtatgagagatcaatacgacaccctgatgaattctgg
ggcgagatagcgaatgagttccattggcgcgtgccgccggcccagccctttctccggtac
aactttgacgtcacaaaagggaagatttttattgaatggatgaaaggaggggtcaccaac
atctgctacaatgtcctagacagaaacgtccaagacaagaagcttggggacaagattgcc
ttttactgggaagggaatgagcctggagattccatgtcgatcacatattcggaacttctc
aggaaggtctgtcagtttgccaatgtcctacgtggccaaggaatcaagaaaggcgaccgt
gtctccatctacatgcccatggtgattgagctggtggtggcaatgttggcttgtgccaga
attggggctatccactccatagtgtttgcagggttttcctccgagtcgctgtgtgagcgg
atcctagattccaactgcactctactcatcacagcagatggtttcttccgtggggacaaa
ttaataaacttgaagtcgattgcagatgaagcgctaaagaaatgtgcagaaaagaactat
cctctgagtaagtgcattgtactgaaacaccttggcagagatgagattgtcagtgatgga
cccagcaaaatctcccctccttgcaagagacagtgtcccgacctccagggaaaaaagcag
gagaaaccaaagagatctcatccacagatcaactggaagccatcggtggatatgtggtgg
cacgaactaataaaggacgcgagcgtggagtgtgagccggagtggtgtgatagcgaagac
gagttatttattctctataccagcggatctacaggcaagcctaagggagtggtgcacact
gtaggcggctacatgatctacactgcaactacattcaagtatgtgtttgattaccaccct
gacgatgtgtactggtgcacagctgacatagggtggatcactggacattcctacctcacc
tacggaccacttgccaatggggccaccagtgttttatttgaaggtcttccaatataccca
gatatctccagaatgtggcaaatcattgataagtataacgtgagcaaattctacacggca
cctaccgccatccgcctgctcatgaagtatggggaggagccagtaaaaaggtacagcagg
aagtcactaaaggttctaggcacagtgggagagccaattaatccagaggcttggctgtgg
tattacaacgttgtgggggataagagatgcccaattgtggatacgttctggcagactgag
acgggaggacatgttcttactccactgccgggagctaccacagccaagccgggctcagct
acgttcccattttttggagttgttccagcaattttagatgaatctggagaggaacttgag
ggcgaagctgaagggtacctggtatttaaacagccatggccggcactaatgcgtaccgtg
tatggaaaccaggaacggtttgagaccacatattttaagaaatttccaggttactatgta
acaggcgatggatgcagaagggataaagacgggtattactggatcacagggcgaattgac
gacatgctcaatgtttctggccacctgctgagcacagcagaggtggagtctgcgcttgta
gaacactcgtccatagctgaggcggccgtggtgagccatccgcacccagtgaaaggggag
tgcctgtactgctttgtcactctaagggatggacacgagttcaccagcacgcttgtcgac
cagctgaagaaactggttagggaaaagattggacccattgccactccggattatatccag
aatgcccctgggctccccaaaacacgctcaggtaaaatcatgcggcgggtactaaggaag
attgccaaaaatgaccgtgacctgggagacatttccacactagccgatagtacagtcata
caacagttatttgagaacaggtgtaaaactgtgcagtag

DBGET integrated database retrieval system