KEGG   Xenopus tropicalis (western clawed frog): 100486264Help
Entry
100486264         CDS       T01011                                 

Gene name
acss2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100486264 (acss2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100486264 (acss2)
   00620 Pyruvate metabolism
    100486264 (acss2)
   00640 Propanoate metabolism
    100486264 (acss2)
Enzymes [BR:xtr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100486264 (acss2)
Lipid biosynthesis proteins [BR:xtr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100486264 (acss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 692 aa AA seqDB search
MSSPGVFPPAPEVSAAAHIPSYARYQELYERSIRHPDEFWGEIANEFHWRVPPAQPFLRY
NFDVTKGKIFIEWMKGGVTNICYNVLDRNVQDKKLGDKIAFYWEGNEPGDSMSITYSELL
RKVCQFANVLRGQGIKKGDRVSIYMPMVIELVVAMLACARIGAIHSIVFAGFSSESLCER
ILDSNCTLLITADGFFRGDKLINLKSIADEALKKCAEKNYPLSKCIVLKHLGRDEIVSDG
PSKISPPCKRQCPDLQGKKQEKPKRSHPQINWKPSVDMWWHELIKDASVECEPEWCDSED
ELFILYTSGSTGKPKGVVHTVGGYMIYTATTFKYVFDYHPDDVYWCTADIGWITGHSYLT
YGPLANGATSVLFEGLPIYPDISRMWQIIDKYNVSKFYTAPTAIRLLMKYGEEPVKRYSR
KSLKVLGTVGEPINPEAWLWYYNVVGDKRCPIVDTFWQTETGGHVLTPLPGATTAKPGSA
TFPFFGVVPAILDESGEELEGEAEGYLVFKQPWPALMRTVYGNQERFETTYFKKFPGYYV
TGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHSSIAEAAVVSHPHPVKGE
CLYCFVTLRDGHEFTSTLVDQLKKLVREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRK
IAKNDRDLGDISTLADSTVIQQLFENRCKTVQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccctggggttttccctcctgccccggaggtctcagctgctgcccacatccca
tcatatgcgagataccaggagctgtatgagagatcaatacgacaccctgatgaattctgg
ggcgagatagcgaatgagttccattggcgcgtgccgccggcccagccctttctccggtac
aactttgacgtcacaaaagggaagatttttattgaatggatgaaaggaggggtcaccaac
atctgctacaatgtcctagacagaaacgtccaagacaagaagcttggggacaagattgcc
ttttactgggaagggaatgagcctggagattccatgtcgatcacatattcggaacttctc
aggaaggtctgtcagtttgccaatgtcctacgtggccaaggaatcaagaaaggcgaccgt
gtctccatctacatgcccatggtgattgagctggtggtggcaatgttggcttgtgccaga
attggggctatccactccatagtgtttgcagggttttcctccgagtcgctgtgtgagcgg
atcctagattccaactgcactctactcatcacagcagatggtttcttccgtggggacaaa
ttaataaacttgaagtcgattgcagatgaagcgctaaagaaatgtgcagaaaagaactat
cctctgagtaagtgcattgtactgaaacaccttggcagagatgagattgtcagtgatgga
cccagcaaaatctcccctccttgcaagagacagtgtcccgacctccagggaaaaaagcag
gagaaaccaaagagatctcatccacagatcaactggaagccatcggtggatatgtggtgg
cacgaactaataaaggacgcgagcgtggagtgtgagccggagtggtgtgatagcgaagac
gagttatttattctctataccagcggatctacaggcaagcctaagggagtggtgcacact
gtaggcggctacatgatctacactgcaactacattcaagtatgtgtttgattaccaccct
gacgatgtgtactggtgcacagctgacatagggtggatcactggacattcctacctcacc
tacggaccacttgccaatggggccaccagtgttttatttgaaggtcttccaatataccca
gatatctccagaatgtggcaaatcattgataagtataacgtgagcaaattctacacggca
cctaccgccatccgcctgctcatgaagtatggggaggagccagtaaaaaggtacagcagg
aagtcactaaaggttctaggcacagtgggagagccaattaatccagaggcttggctgtgg
tattacaacgttgtgggggataagagatgcccaattgtggatacgttctggcagactgag
acgggaggacatgttcttactccactgccgggagctaccacagccaagccgggctcagct
acgttcccattttttggagttgttccagcaattttagatgaatctggagaggaacttgag
ggcgaagctgaagggtacctggtatttaaacagccatggccggcactaatgcgtaccgtg
tatggaaaccaggaacggtttgagaccacatattttaagaaatttccaggttactatgta
acaggcgatggatgcagaagggataaagacgggtattactggatcacagggcgaattgac
gacatgctcaatgtttctggccacctgctgagcacagcagaggtggagtctgcgcttgta
gaacactcgtccatagctgaggcggccgtggtgagccatccgcacccagtgaaaggggag
tgcctgtactgctttgtcactctaagggatggacacgagttcaccagcacgcttgtcgac
cagctgaagaaactggttagggaaaagattggacccattgccactccggattatatccag
aatgcccctgggctccccaaaacacgctcaggtaaaatcatgcggcgggtactaaggaag
attgccaaaaatgaccgtgacctgggagacatttccacactagccgatagtacagtcata
caacagttatttgagaacaggtgtaaaactgtgcagtag

DBGET integrated database retrieval system