KEGG   Xenopus tropicalis (western clawed frog): 100486502Help
Entry
100486502         CDS       T01011                                 

Gene name
rasgrf2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100486502 (rasgrf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1232 aa AA seqDB search
MQKTVRLNEGHTLHLALLARKEGSKRGALSKKATETNRWHEKWFALYQNVLFYFESEQSG
RPSGVYLLEGCSCERVIAPIVASGGKDTMEKQHYFTVTFGHEAQKPLELRCEEEPDRDEW
VEAIHQASYSDVLIEREVLMQKYIHLVQIVETEKIAANQLRQQLEDQDTEIERLKSEIVA
LNKTKERMRPYQMNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKR
NQIVFNMVEAEAEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARINNWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYETNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLDFAQSKLEELSR
VMHDEVSDTENIRKNLSIERMIVEGCDILLDTSQTFVRQGTLIQVPSVERGKLSKVRLGP
LSLKREGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDLGEDDTKGTG
YVFGHLDFKIVIEPVDSPSFTVVLLAPSRQEKAAWTSDISQCVENIRCNGLMSNVFEENS
KVTVPHMIRSDARLHKDDVDICFSRTLNSCKVPQIRYASVDRLLERLTDLRFLSIDFLNT
FLHTYRIFTAAFVVLEKLADIYKRPFTSIPVRSLELFFATSQNLSDGKSPHLCRKFSSPP
PLSLSRTSSPIRARKLSLNSPLNSRIGALDLSTSSSASSPTSVFSPATSPPPTTAKVPLD
LSKGLSSPEQSPGSIDENSENPRIDLCNKLRRSIRRAAVLESVSLDRTIPESSQSTDTAE
NSPCRSPSTPRHLRYRPTGVQASDNQRGCSVSPASAFAIATAGAGHGSPPGFNNMERICD
KEFIIRRAATNRVLNVLRHWVSKHAQDFELNHEIKMNVVNLLEDVLRDPDLLPQERKAAT
NILSALSQEEQDDCHLVLEDIINMSESPSSECLETLSAMELAEQITLLDHIVFRSIPYQE
FLGQGWMKPDKSERTPYIMKTSQHFNDMSNLVASEIMKHPDVPSRASSIEKWVVVADICR
CMHNYNGVLEITSALNRSAVYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKN
CNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQ
PKVTQFLLNKSRILDEDNLYELSLRIEPRLPA
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagactgtgcgccttaacgagggccacactctgcacctggccctgctggcccgc
aaggaggggagcaagaggggcgccctcagcaagaaagccacggagaccaacaggtggcac
gaaaagtggtttgccctctaccagaatgtcctcttctacttcgagtcggagcagagcggg
agaccctcgggggtttatttgctggaggggtgcagttgtgagagggtcatagcacccatt
gtggccagcgggggcaaagacaccatggagaagcagcattacttcactgttacctttggt
catgaagcacagaagcctttggagctacgctgtgaagaggaacctgaccgagatgaatgg
gtggaagccatacaccaagcgagttactctgatgtcctgatagagagagaagtcctgatg
cagaagtatattcatttggtgcaaattgtagaaaccgagaaaattgctgccaatcaactg
cgacaacagcttgaagatcaagatactgaaatagaaaggcttaaatccgagattgtagcc
cttaataaaacaaaggaaagaatgcgtccctatcaaatgaatcaagaggacgaggatcca
gacattaagaagataaaaaaggttcaaagttttatgcgtggatggctttgcaggagaaaa
tggaaaacaattgtgcaggactatatctgttccccccatgctgaaagcatgaggaaacgt
aaccaaattgtttttaatatggtggaagcagaggcagaatatgtgcatcagctttatata
cttgtcaactgcttccttaggcccctcagaatggcagccagctccaagaaacccccaata
agccatgatgatgtaagcagcatcttcctaaacagtgaaactataatgtttcttcatgaa
atattccaccagggattgaaagcaagaattaataattggcctactttgattttagctgac
ttattcgatatcctgctaccaatgttgaacatctaccaagagtttgttcgtaatcatcaa
tatagtctgcaagtgctggcgaactgtaaacaaaacagagattttgacaaactcttgaag
caatatgaaaccaatccagcttgtgaagggaggatgctcgagacattccttacctatccc
atgtttcagatccctcggtacatcataacactccatgaacttcttgcccacacaccccat
gagcatgtagagagaaaaagcttagactttgcacaatcaaaactggaagagctgtcaagg
gttatgcacgatgaagtcagtgacacagagaacattcgcaagaacctctccattgagaga
atgatagtggaaggctgtgatattttattagatacaagccagacatttgtacgccaaggt
actcttattcaggttccttctgtggaaagggggaaacttagtaaagtccgcctgggccca
ttgtcactgaaaagagaaggggaacgacaatgcttcttatttacaaagcattttttaatt
tgcactagaagctcaggggggaaactccatttactcaagacagggggagttctgtccttg
atagaatgtacattgattgaagagccagatctgggtgaagatgacacaaagggtacaggg
tatgtttttggacatttggatttcaagattgtcatagaaccagtggattccccttcattt
actgtggtccttcttgcaccatcacgtcaggaaaaagctgcttggacaagtgatatcagc
cagtgtgtagagaacataaggtgcaatggcttgatgagtaatgtatttgaggagaactcc
aaagttacagtcccacacatgatcagatcagatgcacgattacataaagatgatgtggat
atctgctttagcagaacactgaactcgtgcaaagtccctcagatacgatatgcaagtgtg
gatcgcctgttggagaggttaactgacttgcgcttccttagcattgattttctcaacaca
ttcctacacacctatcggatatttactgctgcatttgtggtgcttgagaagcttgctgat
atttacaaaagacccttcacatcaatccctgtcagatccctggaactgttttttgctaca
agccaaaacctcagtgatgggaaatcaccacatctctgtcgcaagttctcctcaccacca
cccttgtctctttcaagaacctcttctccaatcagggccaggaaactatcacttaattct
ccactgaactcaagaattggagctttggatttatccacttcatctagtgcaagcagccct
acctctgttttcagccctgccacttctccacctcccacaactgctaaagtacctcttgat
ctcagtaaaggactctcctctccagagcaaagtcccggatccattgatgagaattctgaa
aaccctcgtattgatttgtgcaacaaattgagaagaagtattcgaagagctgcggtttta
gaatctgtttcactggataggaccattcctgagagcagccagtctacagatacagctgaa
aattcaccatgtaggtccccctcaactccgcgccatctccggtaccgcccaacaggagtg
caggcatctgacaaccagcgtggatgttctgtctccccagcctctgcctttgccattgct
acagctggagctggtcatggaagtcccccaggctttaataacatggagagaatatgcgac
aaggagtttataatccgcagagctgcaacaaaccgagtattgaatgttcttcgtcactgg
gtctctaagcatgcacaggattttgagttaaaccatgaaataaaaatgaatgttgtcaat
ttgctggaagacgttcttcgtgaccctgacctgctaccccaagagagaaaagcagctact
aacatattaagtgccctatctcaggaggaacaagatgactgccacctagtcttggaggac
attataaacatgtcagagagtcccagctcagagtgcctggaaaccctatctgctatggaa
ctggcagagcagataaccctcttagatcacatagtgtttagaagcataccataccaagag
tttcttggtcaaggttggatgaaaccagacaaatctgagaggacgccatatataatgaaa
actagtcaacattttaatgatatgagtaaccttgttgcctcggagatcatgaaacaccct
gatgtcccatccagagcaagctcaattgagaagtgggtagtggtagcggatatatgccga
tgtatgcacaattacaatggagtgctggagatcacatccgccttgaacagaagtgctgtc
tacagactcaagaaaacttgggctaaagtttctaaacagacaaaggctctaatggataag
cttcaaaagactgtatcatctgaaggaagatttaaaaatcttagagaaaccctcaaaaac
tgtaaccccccttcagtgccctaccttggaatgtatttgaccgaccttgcatttatagaa
gagggtaccccaaacttcactgaggaggggcttgtaaatttttctaaaatgcgaatgata
tcgcatataattagagaaatacggcaattccagcagaccccttaccgcatagagcatcag
cctaaggttactcagtttcttctgaacaagtctcgcattctggatgaagataatctatat
gaattgtcattgcgaattgaaccgcgtctcccagcatga

DBGET integrated database retrieval system