KEGG   Xenopus tropicalis (western clawed frog): 100486582Help
Entry
100486582         CDS       T01011                                 

Gene name
bcmo1
Definition
beta-carotene 15,15'-monooxygenase 1
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100486582 (bcmo1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     100486582 (bcmo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
MQNINTVESVVDVIFSFDRKDCPEPVKAEVRGEIPKWLQGTLLRNGPGIHKVGEMHYNHW
FDGLALLHSFTFKNGEVHYRSKYLKSDTYNSNMEANRIVVSEFGTMAYPDPCKNIFSKAF
TYLSHVVPEFTDNCLINIIKLGEDFYASSETNFIRKINPQTLDTLEKVDYMKYVTVNIAT
SHPHYDSAGNTLNMGTSIGDKGKTKYILFKIPAKIPDNGKKSLLKHAEVVCSIPSYRLLS
PSYYHSFGLTENYVIFIEQPLKLDIVKLATAYFRGVNWASCITFNGDEKTWFHIIDRRTR
KPISKKFYADALVTYHHINAYEEDDHLIFDIIAYKDNGLYDMFYLANLKKDFSQETAMTS
VPVCKRFVIPLQYDKNVNVGVNLVRIPMTMAKAVKDDNGDIYCEPETMCEGIELPRINYD
FNGKKYRYVYATHVEWRPIPTKIVKFDTVTKDMLSWTEDMCWPAEPMFVSHPDAKEEDDG
VILSSVVSSDPNKAPFLLVLDAKTFQELGRASVNANIHLDLHGLFIPENNVTK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacatcaacactgtagagtctgtggtagatgttatcttctcgtttgaccgcaag
gactgccctgagcctgtcaaggcggaggtgagaggtgaaattccaaagtggctgcaggga
actctactacgcaatgggcctggaatacacaaagttggagagatgcactacaaccattgg
tttgatggacttgctttattacacagcttcacttttaaaaatggtgaagttcactacaga
agtaaatacctcaaaagtgatacatacaactccaatatggaggccaatcgaatagtagta
tcagaatttgggaccatggcttatccagatccatgcaaaaatattttctccaaagcattt
acctacctgtcacatgtggtgcctgagttcactgataactgcctaatcaatatcataaag
cttggtgaagatttttatgcatcttctgaaaccaactttatcaggaaaataaatccacag
actttggacaccttggaaaaggtagattatatgaaatatgtaactgtaaacattgccact
tctcaccctcattatgattctgctggcaacacattaaatatgggaacatcaattggtgac
aaaggaaaaaccaaatacatattatttaagatcccagctaagattccagacaatggaaag
aagtccctgctaaaacatgctgaagtagtttgttctatcccatcttatcggttactgagc
cccagctactaccacagctttggattgacagagaattacgtcatattcattgagcaacca
ttaaagctagatattgttaaactggcaacagcctacttccgaggagtcaactgggcttca
tgcattaccttcaatggagatgagaagacttggtttcatattattgatagaagaactaga
aaacctatttcaaaaaaattctacgctgatgcccttgtcacataccatcatatcaatgcc
tatgaagaagatgaccatttaatatttgatattattgcctacaaagacaatggcttatat
gatatgttttatttggcaaatttaaagaaggacttctctcaggaaacagctatgacctca
gtgccagtttgtaaacgttttgtcatcccactccagtatgacaagaatgtaaatgtgggg
gttaatttggtaaggattccaatgactatggcaaaagcagtaaaggatgacaacggtgat
atatattgtgagccagagaccatgtgtgaaggtattgaacttccacggatcaactatgat
tttaatggcaaaaagtacagatatgtatatgcaactcatgtggaatggcgaccaattcca
accaagatagtaaagtttgacactgtgacaaaagatatgttgtcttggaccgaagacatg
tgctggcctgcagaaccaatgttcgtttcacatccagatgccaaagaagaggatgatggg
gtcatactgtcctctgttgtgtcttcagatcctaataaagctccatttttgcttgtactg
gatgcaaaaacatttcaagagcttggacgggccagtgtcaatgcaaacatccatttggac
ctgcatggattgttcataccggagaataatgtaacaaaatga

DBGET integrated database retrieval system