KEGG   Xenopus tropicalis (western clawed frog): 100486781Help
Entry
100486781         CDS       T01011                                 

Gene name
por
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100486781 (por)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 680 aa AA seqDB search
MGESCAEQDMCTSEQGNSSPEEAFFSMADMFLLSLIVGLLTYWFFFRKKKEETIEFTKIQ
PTVSSSVRESSFIEKMKKTGKNIVVFYGSQTGTGEEFANRLAKDAHRYGMRGMAADPEEF
EMTDLSRLTEIENALAVFCMATYGEGDPTDNAQDFYDWLQETDIDLAGLKYAVFGLGNKT
YEHFNAMGKYVDKRLEELGAERIFELGMGDDDGNLEEDFITWREQFWPAVCEHFGVEATG
EDSSIRQYELVVHTDENMNKVYTGEMGRLKSYETQKPPFDAKNPFLANATVNRKLNEGGD
RHFMHLELDITGSKIRYESGDHVAVYPANDAALVNKLGEILGADLETVISLNNLDEESNK
KHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYATDSKEQENLRKMASSAQDGKALYL
SWVVESRRNILAILEDIPSLRPPLDHLCELLPRLQARYYSIASSSKVHPNSIHVCAVLVE
YETKTGRENKGVATNWLKNKQPSDNGHKSSVPMFVRKSQFRLPFKPSTPVIMIGPGTGIA
PFMGFIQEREWLKQQGKDVGETVLYYGCRHEHEDFLYINELKRYHKEGVLTQLNVAFSRD
QAHKVYVQHLLKNNKEMVWKLIHEDNAHIYVCGDARNMARDVQNIFYDIVEEYGKLDHAQ
AVDYIKKLMTKGRYSQDVWS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgggggagtcttgtgcggaacaagatatgtgtacatcggagcagggaaacagctctcct
gaagaggcatttttcagtatggcagatatgtttcttttgtctctcatagttggcctgctg
acttactggttcttttttcggaagaagaaagaagagaccattgaattcaccaaaattcag
cccaccgtgagttcctctgttcgagaaagcagttttattgaaaagatgaaaaagacagga
aaaaacattgtggtattctatggttctcagactggaacaggagaagaatttgccaatcgg
ctggccaaggatgcccaccggtatggcatgcgtggaatggctgctgacccagaagaattt
gaaatgacagatctcagtcgtctcacagaaattgagaacgctcttgctgttttctgcatg
gccacttatggtgaaggtgatcctacagataatgctcaggatttctatgactggcttcag
gaaacagacattgaccttgcaggacttaagtatgcagtttttggccttggcaacaagaca
tatgagcactttaatgccatgggaaaatatgttgacaaaagacttgaagaattaggagct
gagcgcatttttgagcttggaatgggagacgatgatggcaacctggaagaagactttatc
acatggagggagcagttctggcctgcagtttgtgaacactttggagttgaggcaactgga
gaagattccagcattcgtcaatatgaacttgtggtgcacacagatgagaatatgaacaag
gtgtacacaggagagatgggtcgactaaagagctatgaaactcaaaaaccaccttttgat
gctaaaaatccttttctggctaatgcaacagttaaccgcaaacttaatgagggtggagac
cgacatttcatgcatttggaactagatatcactggctcaaagataagatatgagtcggga
gatcatgtggctgtgtacccagcaaatgatgctgcgctcgtaaacaagttgggagagatc
ctgggagcagaccttgaaactgtgatttctctgaacaacctggatgaggagtctaacaaa
aagcaccctttcccctgtcctaccacatatcgtactgccctcacttactacttggacatt
accaatccaccccggaccaatgtgctttatgaactagcacagtatgccactgactccaag
gagcaagaaaacctgcgcaagatggcctcctcagcacaagatggaaaggctctctatctc
agttgggttgttgaatcaagaagaaatattttggccatactagaagatataccttcactg
cgccctccattggatcacctttgtgaactgctgccacgcttacaggcccgatattactcc
attgcatcctcctcaaaagttcatcccaattccatccacgtctgtgctgtgcttgttgaa
tacgagacaaaaacaggcagagaaaataaaggagtggctacaaattggctcaaaaacaaa
cagcccagtgacaatggacacaagtcatctgttcccatgttcgtgcgcaagtcccagttc
cgccttccattcaagcccagcacacctgtaatcatgattggccctgggacaggcattgcc
ccattcatgggtttcatccaggaaagagagtggcttaagcagcaaggcaaggatgttggg
gaaacggtgctgtactatggctgccgccatgaacatgaagatttcctttacataaatgag
ttaaaacggtatcacaaggaaggagtcctaacacagctgaatgttgccttctcaagagac
caggcccacaaggtttatgtgcagcatcttctaaagaacaacaaagagatggtatggaag
ctaatccacgaagataatgcccatatttatgtctgcggtgatgcccgcaacatggctcgg
gatgtgcagaacattttctatgatattgtggaagaatatggaaaacttgaccatgctcag
gctgtggattacatcaagaaactaatgaccaaaggccgctattcccaagatgtctggagt
taa

DBGET integrated database retrieval system