KEGG   Xenopus tropicalis (western clawed frog): 100486846Help
Entry
100486846         CDS       T01011                                 

Gene name
syk
Definition
(RefSeq) spleen tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100486846 (syk)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100486846 (syk)
Protein kinases [BR:xtr01001]
 Non-receptor tyrosine kinases
  SYK family
   100486846 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase DUF4348 RIO1
Motif
Other DBs
NCBI-GeneID: 100486846
NCBI-ProteinID: XP_002937073
Xenbase: XB-GENE-978184
Position
1
AA seq 631 aa AA seqDB search
MADIAQNLPYFFGNITREESEDYLRQAGAADGLYLLRQSRSYLGGYALSVAHGRHFYHYT
IERELNGTYAISGGISHSSPAELCHYHTLESSGLVCLLKKPCNRLPGVQPKTGPFEDLKE
HLIREYVHQTWNLQGEALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISG
VKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYS
YKPDGLLRVLTEPCPRATGHSESFIFKRAPCPAPPTQHQMSWSAGGIISRFKSYSFPKPG
NKKMTLSTAGAPRRHGSSTSINTYVHRPNAEVTMDSMPMDTDVYRGIYEDPDEFRPMDGK
ISREQLTLFETELGSGNFGNVKKGELKTSKSKKPVAVKILKNDSNDESMKDELLKEAKVM
QLLNNPYIVRMLGICEGESWMLVMELAGLGPLNKFLVKNKNVTEHNVTELVHQVSMGMKY
LEETNFVHRDLAARNVLLVTQHYAKISDFGLSKALESDENYYQAKTAGKWPMKWYAPESL
NYHKFSSKSDVWSFGVLMWEAYSYGLKPYPGMKGNEVTAFIESGNRLECPRRCPAEMYNL
IKLCWTYKTEERPSFAVVELKLRSYYYDSSH
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcagatattgcccagaatctgccatacttttttggcaatattactcgtgaagaatct
gaagattacttgaggcaagctggtgcagctgatggcctgtatctgttgcgtcaaagtcgt
agctaccttggtggttacgctctatcagtggcacatggcagacatttttaccattatact
attgaaagagagttaaatgggacttatgcaatttcaggtggcatatctcatagcagccct
gctgaactgtgtcattatcacacactagagagcagtggacttgtctgcttgctcaagaaa
ccatgcaatcggctacctggtgttcaaccaaaaaccggaccatttgaagatcttaaagaa
catctcatcagagaatatgtacatcaaacatggaatttacagggtgaagctctggaacaa
gctattatcagccagaaacctcagctagagaagctaattgccacaaccgcacatgaaaaa
atgccatggttccatggaaggatttcacgtgaagattctgagcagttacttatcagtgga
gtaaaatcaaatggatcttttctaataagagaacgagatgataatggatcatatgcccta
tgtctgctacacgacagaaagatttctcattaccgtattgaccgagacaaaactggaaag
ttatccataccagatgggaagaaatttgatactctctggcagctggttgaacattattcc
tacaaacctgatggacttctgcgggttcttacagaaccatgcccccgagcaactggacac
agtgaaagctttatatttaaacgtgcaccatgtccagcacctcctacccaacatcaaatg
agttggtcagcaggtggaattatctcgagattcaaatcctactccttccccaagcctggc
aacaaaaagatgacactgagtactgcaggggctcccaggcggcacggaagttctacatca
ataaatacttatgtacataggccaaatgcagaagtcacaatggattctatgcctatggac
actgatgtctatcgaggaatatatgaagacccagatgagttcagacccatggatggcaaa
atatctcgggaacagcttactttgtttgaaactgagctaggctctggcaactttggaaat
gttaagaaaggagagttaaagacatcaaaatctaaaaaaccagtagctgtcaaaattctc
aaaaatgacagcaatgatgagtcaatgaaggatgagctgctcaaagaagccaaagtcatg
cagctgcttaataacccttacattgtgaggatgcttggaatctgtgaaggggaatcgtgg
atgcttgtcatggagctggcaggactcgggcctctaaataagttcttggttaaaaacaag
aatgtcacagaacataatgtaacagagcttgtacatcaggtttccatgggaatgaagtat
ttagaagaaacaaattttgtccacagagacctggcagcacgaaatgttttgctggtcaca
caacattatgccaaaatcagtgatttcgggctttccaaagcacttgaatctgatgaaaat
tattaccaagcaaagactgcgggtaaatggcccatgaaatggtatgcccctgaatcatta
aactatcataagttttcaagcaaaagtgatgtatggagctttggagttctgatgtgggag
gcatattcctatggtctaaagccatatccgggaatgaaaggtaatgaagtgacagctttt
attgaatctggaaaccgcttggagtgcccgcgacgttgtcctgcagaaatgtacaattta
attaaattatgttggacatataagacagaggagcgaccatcttttgctgtagttgaactg
aaactgcgcagttattattatgatagttctcactga

DBGET integrated database retrieval system