KEGG   Xenopus tropicalis (western clawed frog): 100486846Help
Entry
100486846         CDS       T01011                                 

Gene name
syk
Definition
spleen tyrosine kinase
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100486846 (syk)
Protein kinases [BR:xtr01001]
 Tyrosine protein kinases
  Syk family
   100486846 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 631 aa AA seqDB search
MADIAQNLPYFFGNITREESEDYLRQAGAADGLYLLRQSRSYLGGYALSVAHGRHFYHYT
IERELNGTYAISGGISHSSPAELCHYHTLESSGLVCLLKKPCNRLPGVQPKTGPFEDLKE
HLIREYVHQTWNLQGEALEQAIISQKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISG
VKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYS
YKPDGLLRVLTEPCPRATGHSESFIFKRAPCPAPPTQHQMSWSAGGIISRFKSYSFPKPG
NKKMTLSTAGAPRRHGSSTSINTYVHRPNAEVTMDSMPMDTDVYRGIYEDPDEFRPMDGK
ISREQLTLFETELGSGNFGNVKKGELKTSKSKKPVAVKILKNDSNDESMKDELLKEAKVM
QLLNNPYIVRMLGICEGESWMLVMELAGLGPLNKFLVKNKNVTEHNVTELVHQVSMGMKY
LEETNFVHRDLAARNVLLVTQHYAKISDFGLSKALESDENYYQAKTAGKWPMKWYAPESL
NYHKFSSKSDVWSFGVLMWEAYSYGLKPYPGMKGNEVTAFIESGNRLECPRRCPAEMYNL
IKLCWTYKTEERPSFAVVELKLRSYYYDSSH
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcagatattgcccagaatctgccatacttttttggcaatattactcgtgaagaatct
gaagattacttgaggcaagctggtgcagctgatggcctgtatctgttgcgtcaaagtcgt
agctaccttggtggttacgctctatcagtggcacatggcagacatttttaccattatact
attgaaagagagttaaatgggacttatgcaatttcaggtggcatatctcatagcagccct
gctgaactgtgtcattatcacacactagagagcagtggacttgtctgcttgctcaagaaa
ccatgcaatcggctacctggtgttcaaccaaaaaccggaccatttgaagatcttaaagaa
catctcatcagagaatatgtacatcaaacatggaatttacagggtgaagctctggaacaa
gctattatcagccagaaacctcagctagagaagctaattgccacaaccgcacatgaaaaa
atgccatggttccatggaaggatttcacgtgaagattctgagcagttacttatcagtgga
gtaaaatcaaatggatcttttctaataagagaacgagatgataatggatcatatgcccta
tgtctgctacacgacagaaagatttctcattaccgtattgaccgagacaaaactggaaag
ttatccataccagatgggaagaaatttgatactctctggcagctggttgaacattattcc
tacaaacctgatggacttctgcgggttcttacagaaccatgcccccgagcaactggacac
agtgaaagctttatatttaaacgtgcaccatgtccagcacctcctacccaacatcaaatg
agttggtcagcaggtggaattatctcgagattcaaatcctactccttccccaagcctggc
aacaaaaagatgacactgagtactgcaggggctcccaggcggcacggaagttctacatca
ataaatacttatgtacataggccaaatgcagaagtcacaatggattctatgcctatggac
actgatgtctatcgaggaatatatgaagacccagatgagttcagacccatggatggcaaa
atatctcgggaacagcttactttgtttgaaactgagctaggctctggcaactttggaaat
gttaagaaaggagagttaaagacatcaaaatctaaaaaaccagtagctgtcaaaattctc
aaaaatgacagcaatgatgagtcaatgaaggatgagctgctcaaagaagccaaagtcatg
cagctgcttaataacccttacattgtgaggatgcttggaatctgtgaaggggaatcgtgg
atgcttgtcatggagctggcaggactcgggcctctaaataagttcttggttaaaaacaag
aatgtcacagaacataatgtaacagagcttgtacatcaggtttccatgggaatgaagtat
ttagaagaaacaaattttgtccacagagacctggcagcacgaaatgttttgctggtcaca
caacattatgccaaaatcagtgatttcgggctttccaaagcacttgaatctgatgaaaat
tattaccaagcaaagactgcgggtaaatggcccatgaaatggtatgcccctgaatcatta
aactatcataagttttcaagcaaaagtgatgtatggagctttggagttctgatgtgggag
gcatattcctatggtctaaagccatatccgggaatgaaaggtaatgaagtgacagctttt
attgaatctggaaaccgcttggagtgcccgcgacgttgtcctgcagaaatgtacaattta
attaaattatgttggacatataagacagaggagcgaccatcttttgctgtagttgaactg
aaactgcgcagttattattatgatagttctcactga

DBGET integrated database retrieval system