KEGG   Xenopus tropicalis (western clawed frog): 100487267Help
Entry
100487267         CDS       T01011                                 

Gene name
plcb3
Definition
phospholipase C, beta 3 (phosphatidylinositol-specific)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100487267 (plcb3)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100487267 (plcb3)
   04020 Calcium signaling pathway
    100487267 (plcb3)
   04070 Phosphatidylinositol signaling system
    100487267 (plcb3)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100487267 (plcb3)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100487267 (plcb3)
   04916 Melanogenesis
    100487267 (plcb3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100487267 (plcb3)
   04270 Vascular smooth muscle contraction
    100487267 (plcb3)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100487267 (plcb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1210 aa AA seqDB search
MAGARPGVHSLQLEPVKVPETLIKGSKFIKWDEEPSSKSLVTLRVDAMGFYLYWTCPNME
VDILDISLIRDTRIGKYAKIPKDMKMREILGFTAPEHRPEDKLFTVVHGTDIVNISFLNF
MAVQEDTAKVWTEELFKLAHNILAQNSSRNTFLQKSYTKLKLQVNQDGRIPVKNILKMFA
ADKKRVETALESCGLNFNRGDSIKPEEFTLDIFERFLNKLCLRPDIDKILLELGAKGKPY
LTLEQLMDFLNQKQRDPRLNEILFPPLKRDQVRQLIEKYEPNRQFLERDQMSMEGFSRFL
GGDENSIVPPEILDLSDDMNQPLSSYFINSSHNTYLTAGQLTGNSSVETYRQVLLTGCRC
IELDCWKGRPQDEEPFITHGFTMTTEIPFKEVIEAIAESAFKTSPFPVILSFENHVDSSK
QQAKMAEYCRNIFGDALLIDPLEKYPLQAGVQLPSPQELMGKILVKNKKRHKVAAKGPEG
SVKRRVSEQTSNTYSDSSSVCESSATGILPSESADVTLTLSNGDEKVEEKPPRYTEPRKS
IDHDAYSEEEEEEEPSDPKKSDEGTASSEVNATEEMSTLVNYVEPVKFKSFDVAKKRNKY
YEMSSFVETKALEQLTKSPMEFVEYNKKQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVAL
NFQTLDLPMQLNVGIFEYNRRSGFLLKPEFMRRTDKHFDPFTENIVDGIVANTVKIKIIS
GQFLSEKRVGIYVEVDMFGLPVDTKRKFRTKTSQGNSFNPVWDEEPFIFPKVVLPTLASL
RIAVFEEGGKFVGHRILPVSAIRPGYHYICLRNELNQPVCLPALLVYTEVNDYIPDDHQG
YANALTNPIKHINLMDQRAKQLIALMGENEQLFNKDKSDWDPKSKPQIRSPDDTPEKNKI
PIIPVPSPPAQRDDHIASVLTDIQAPSMEELKSQKSFEKLICRQYRELRQLRRKHLRKVS
SLCKEQSTWVTQLQSIRRRKPFGRSHRAVSGADQDAEQKFMDMQLDQQKRLLELREIQHE
QERKLKHSHLLQAVQKLQEVAISCHSTQLKKLKEINEKEKKELQKILDRKRHNSITEAKS
RERQKKDVELTEINRRHINESVSSIRRLEEAQKRRQEKLQAAHQETLQRIKDEEPKLQAQ
LDESCQAEFRQLPQEVRRYLQEDGWVGSGSGPPSSSHSSPPSISRSWGSESGEKDSLHSP
GDSSDEATRL
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcacggccaggggttcactctcttcagctggaaccagtcaaagtgccggag
actcttataaaagggagcaagttcatcaagtgggatgaggagcccagcagcaaatccctg
gttactctgcgtgtggatgcaatggggttttatctttactggacctgtccaaatatggag
gttgatattttggatatcagcttgataagggacacccggataggaaaatatgctaaaatt
ccaaaggatatgaaaatgagggagattctgggattcacagccccagagcaccgccctgag
gataaacttttcacagtagtacatggcaccgatattgtgaatataagctttctcaacttc
atggctgtgcaagaggatactgcaaaggtttggacagaagaactttttaaattggcacat
aatattctggcacagaactcatctcggaacacctttctgcagaaatcatacaccaaacta
aagctgcaagtgaatcaagatggacgaattccagtgaagaatatcctaaagatgtttgca
gctgataagaaaagagtggaaacggcgctggaatcttgtggcttgaactttaacagggga
gattctattaaaccggaggaatttactcttgatatttttgaacgcttcctgaacaagctg
tgcctgcgtccggatatcgataagatccttttagaacttggagccaaagggaagccgtat
ctgactctagagcaactaatggactttctaaatcagaaacaaagggacccccgactcaac
gagattctttttcctccacttaaaagagaccaagtgcggcagcttattgagaagtatgag
cccaacaggcagttcctggaaagagaccagatgtccatggaaggtttcagccgcttctta
ggtggagatgagaacagcattgttccgccagagatcctggatctaagtgatgatatgaac
cagccgctcagcagctactttattaactcttcccataacacctacctcacagctggccag
ctaactggaaactcatcagtggagacgtacaggcaagtgctattaactggctgccgctgt
attgagctagactgctggaagggacgcccccaggatgaagaaccgttcataacccatgga
ttcactatgaccactgaaattccttttaaggaagtaattgaagcaatagcagaaagtgcc
tttaaaacatcaccttttcctgtcattttgtcatttgaaaatcacgttgactcttcaaag
cagcaagcaaagatggccgagtactgcaggaacatctttggagatgcattgttaatagat
ccattggagaagtatcctctccaggctggagttcaacttcctagtccccaggaactaatg
ggtaagatcctagtgaagaataaaaaaaggcacaaagtggcagcaaaaggcccagaaggc
agcgtaaaaagaagggtcagcgaacagacctctaatacttacagtgactcatccagtgtg
tgcgagtcttctgctacaggtatcctaccttctgaatcagctgatgttacactgacactt
tccaatggggatgaaaaagtagaggagaaaccccctagatatacagagccacggaaatca
attgatcatgatgcttatagtgaggaggaagaagaagaagagccatcggatcccaagaaa
tctgatgagggtacagcaagcagtgaggtgaatgccacagaggagatgtccacacttgta
aattatgtagaacctgttaagttcaagtcatttgatgtggccaaaaaaagaaataagtat
tatgagatgtcctcatttgttgaaactaaggcattggagcagctcactaaatccccaatg
gaatttgtggaatataacaagaagcagctcagccgcatatacccaaaaggaactcgggta
gattcctcaaattacatgccccagctcttctggaatgcaggatgtcaaatggtggctttg
aactttcaaacgttggatcttccaatgcagctgaatgtgggaatttttgagtataatcga
cgcagtggtttccttctaaaaccagaatttatgcgaaggacagacaagcattttgatcct
tttactgaaaacattgttgatggaattgttgcaaatacggttaaaatcaagattatatca
gggcagtttctatctgaaaagcgagtgggcatatatgtggaggtcgatatgtttggcctg
ccagttgacactaagaggaaatttcgcacaaaaacttcccaaggaaactcatttaatcct
gtctgggacgaagagccttttatttttcctaaggttgtactccccacacttgcctctctc
cgtattgctgtctttgaagaaggtggaaagtttgtaggtcacagaatactgcctgtctct
gctatccgaccaggatatcattacatttgcctaagaaacgagctaaatcagcctgtctgt
ttgccagctctgcttgtttacactgaagtcaatgattatattcctgatgaccaccagggc
tatgccaatgccttaactaaccctatcaagcacatcaacctcatggatcaaagggcaaag
caacttatagctctgatgggagagaatgagcaactattcaacaaagacaagtctgattgg
gatccaaaatcaaagccccagataagatccccagatgataccccagagaagaataagata
ccaattattcctgtgccttccccaccagcgcaacgagatgaccacatagccagtgttctg
acagacatacaagccccctctatggaagagctcaaatcccaaaagagctttgaaaagctg
atctgccgccagtacagagaactgcgtcaactccgtcgcaagcacttgcgcaaggtgtca
tctctgtgcaaggagcagagcacttgggtgacacagctgcagagtatccgcaggaggaag
ccatttggaagaagccatagagcagtttctggtgcagatcaggatgctgagcaaaagttt
atggatatgcagctggaccaacagaagcgacttctggaactgcgagaaattcaacatgag
caggaacgtaaactaaaacacagccacttactgcaggctgttcagaagctccaggaagtg
gccatttcctgccattctactcaactcaagaagttaaaggaaatcaatgaaaaggagaag
aaagagctacagaagatcctggacagaaaacgacataatagcatcacagaggccaagtca
cgggaacgtcagaaaaaggacgtggaactgacagaaattaatagacgtcacattaatgag
tccgtaagctccatacgaaggctggaagaggcccagaaaaggcgacaagagaagctgcag
gcggctcaccaggaaacactgcaaaggataaaagatgaggagccaaagctgcaggcacag
ttagatgagtcttgccaagctgagttccgccagctgccccaggaggtccgacgttacttg
caggaggatggctgggttggcagtggttcaggtcctccctcttcttcacacagcagcccg
ccctcaataagccggagctgggggtcggagtctggcgaaaaagattctcttcattcccct
ggagactcaagtgatgaagccaccaggctctga

DBGET integrated database retrieval system