KEGG   Xenopus tropicalis (western clawed frog): 100487608Help
Entry
100487608         CDS       T01011                                 

Definition
alcohol dehydrogenase 1-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100487608
  Lipid metabolism
   00071 Fatty acid degradation
    100487608
  Amino acid metabolism
   00350 Tyrosine metabolism
    100487608
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100487608
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100487608
   00982 Drug metabolism - cytochrome P450
    100487608
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100487608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 373 aa AA seqDB search
MESAGQVIKCKAAVTWEKDAPFSIEEIEVAPPKAHEVRIKLIATGICRSDDHSLEGKFAA
VKFPVILGHEGVGIVESIGDGVKDIKPGDKVIPLVAPQCGKCQCCKDPRTNRCLTRLKRQ
FGLMSDGTSRFTCRGKQIYHFMNTSTFTEYTVVEEMAVAKIDDNATMDSVCLIGCGFSTG
YGSALNTAKVHPESTCAIFGLGGIGLAVIMGCKIAGAARIIGVDINPDKFDIAKELGATE
CINPNDYDKPVAEMILEQTGGGVDYAFECVGHAETMLAALHSSHFAFGTTVIIGASASTL
SFDPMILLSGRTLKSSSFGGWKSRLEVPKLVSDYLAKKFDLEKLVTHRLPFQKISEGFDL
LHSGKCIRTILKF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagcaggacaagttattaaatgcaaggcggctgtgacatgggaaaaagatgca
cccttttcaattgaggagatagaagttgctcccccaaaagcccatgaagttcgtattaag
ctgatagcaacaggtatctgtcggtctgatgaccattcactcgaggggaaatttgcagct
gtaaaattcccagttattcttggccatgagggagttggtattgttgaaagcattggagac
ggtgtgaaagacattaagccaggagacaaagtcattccattagttgcacctcaatgtgga
aaatgccagtgttgcaaggatccaaggactaatagatgtctcaccagactgaaaagacaa
tttggactcatgtctgatggcaccagcagatttacctgcagagggaagcaaatctaccac
ttcatgaacaccagcacttttactgaatacactgtagttgaggaaatggcagttgctaag
attgatgataatgcaacaatggatagtgtctgtctcattggatgtggtttctccactggt
tatgggtcggcattaaataccgccaaggtgcacccagaatctacttgtgccatatttggt
ttaggaggaattggccttgctgtcattatgggctgtaagatagctggggcagctcgcatc
attggagtagatatcaatcctgacaaatttgacatagcaaaggaactaggagcgactgaa
tgtataaaccccaatgattatgataaaccagtagcagaaatgattctggagcagactgga
ggtggcgtggactatgcatttgaatgtgttggccatgctgaaactatgttagctgcacta
cactcaagtcactttgcatttggaacaacagtcataattggagcatctgcatcaactctt
tcctttgatccaatgatcctgttgtctggacgcacacttaaaagctcttcttttggaggc
tggaagtctaggctggaagttccaaaattagtttctgattatttggcaaagaaatttgac
ctggaaaagttggtgacgcaccgattaccttttcagaagatcagtgaaggatttgatctt
ttacattctggcaaatgcattcggacaatcctgaaattttaa

DBGET integrated database retrieval system