KEGG   Xenopus tropicalis (western clawed frog): 100487624Help
Entry
100487624         CDS       T01011                                 

Gene name
itga8
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  
integrin alpha 8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100487624 (itga8)
   04514 Cell adhesion molecules (CAMs)
    100487624 (itga8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100487624 (itga8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100487624 (itga8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1081 aa AA seqDB search
MKLLSNTHSAAAASLLRALLPRHLYPQKMLSRWRPIAQQPACPMLMVIMLSGVCSAFNLD
VEKVTVYSGPPDSYFGYSVDFYLPDSAKTSILIGAPKANTSQPQIVEGGAVYYCPFPDTL
PTGCKQIPFDITNNRNIRLNGTKQPVEFKSNQWFGATVRAHKEKVVACAPLYHWRSIKPI
SEKDPVGTCYIAIQNFSAYAEYSPCRSDLADPAGQGVCQAGFSLDFYKNGDLALGGPGSF
YWQGQVFTASIADIIKDYSFKSIIRKISGEKQTKMAQSAYDDSYLGYSVAVGEFTDDSVQ
EVVAGVPRGAQNFGYVSIINSTDMTFIQNFTGDQMASYFGYTVAVSDVNNDGLDDILVGA
PLFMDREFESNPREVGKVYLYMQESALEFRDPQVLKGTEVFGRFGSAIAHLGDLNQDGYN
DIAVGSPFAGEDRKGRVFIYNGNSNGLNTDTSQILEGAWASQSMPAGFGFTLRGDSDIDK
NDYPDLIVGAFGAGKAVVYRARPVITVDAQLLLHPMILNPENKTCQLPNSEFLVTCFTVR
VCVTVSGQSIPSNIVVKADLELDWLKQKGAVKRTLFMESHQAHHSFDLIINKQRLSQCLD
FLVYLREESEFRDKLTPISVNLNYSLDESAYLGDQELKPILNRYKKATIQEQAHILVDCG
EDNMCIPDLKLSARPDKNQLVIGEENHILFIINTKNQGEGAYEAELRMIIPPEADYVGIE
RNMEGLRQLNCEYKMENESRLVVCDLGNPMVAGTNLSVGLRFVVQRLETVDAITFDLYIK
SSNKDNPNSNFVSLQVNITAVAQVEIRGVSHPPQIILPIPNWEPKEKPSEEKDVGPLVQH
IYELHNIGPSAISETQLNVGWPSQSRDEFLLYVFHIQTEGPLKCQAGSAINTLNIKPSEP
EDTPELAAFLRNTSVSHAVSRRDVAVAEALRHIPTPTKLLNCTNVKCLMISCKVGHLGGG
QRAVVKIRSRLWAPTFLQRKNDYYSLIANVSFEVKKMPYDIQPAKLPAATILIKTSVIWA
TPNISFAIPLWVILLAILLGILVLAILTLVMWKCGFFDRARPPQDDVADDTQQLTNKTAE
A
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgctcagtaacacacacagcgctgctgccgcctcactgctccgggctctcctt
ccgcgccacctttacccacagaagatgctgagccggtggcgccctatcgcccagcagcca
gcatgccccatgctcatggtgataatgctgagtggcgtttgttctgcctttaacctggat
gtagagaaagtgacagtgtacagcggccccccggatagttactttggctactctgtggac
ttctacttgcccgactcggcaaaaactagtattctcattggagcgcccaaagccaatacc
tctcagccacagatagtggaaggaggagccgtgtattactgtcccttccccgataccctg
cctactggatgcaagcagattccatttgatatcacaaacaacaggaacatcaggttaaat
ggaaccaaacagcctgttgaattcaagtcaaaccaatggtttggtgcaacagtcagggct
cataaggaaaaagttgtggcttgtgccccactgtatcactggagaagtattaagcccatt
tcagaaaaggatcctgttggcacttgctacattgccattcagaatttcagtgcttatgct
gaatactctccctgccgaagtgaccttgctgatcctgctggacaaggcgtctgtcaagct
ggcttcagtctggatttttataagaatggagacctggcgttgggagggcccggaagtttt
tactggcaaggacaagtctttactgccagtatagcagacataattaaagactattccttc
aagagcattatcaggaagatatcgggcgagaaacaaacaaaaatggcacaatctgcttac
gatgatagctacttaggatactctgtggctgttggagaatttactgatgattcagtgcaa
gaggtggttgccggagttccaaggggagcacaaaactttggatatgtctctatcatcaat
tcaactgacatgaccttcattcagaactttacaggtgaccagatggcctcttactttgga
tacactgttgctgtgtcagatgtaaacaatgacgggttggatgatatcttagttggagcc
ccacttttcatggatcgagaattcgagagcaatccaagggaggttggaaaagtctacttg
tacatgcaagaaagcgctcttgaatttagagacccccaagtactgaaaggcacagaagtc
tttgggagatttggtagtgctattgcccatttaggcgatcttaatcaagatggatacaat
gacattgcagttggctcaccatttgcgggggaagacagaaaaggcagagtgtttatctac
aatgggaacagcaatgggttaaacacagatacctcccagatactggaaggagcttgggcc
tcgcagtcaatgcctgctggatttggctttacgctgagaggcgattcagacatagacaaa
aacgattacccagatcttattgtgggagcttttggagcaggaaaagctgttgtttataga
gcgagaccagtgatcactgttgatgctcaacttttgctccaccccatgattctgaaccca
gagaataaaacctgccagctccccaattcagaatttctggtgacttgtttcactgtaaga
gtgtgtgtgactgtgtctgggcaaagcatcccttcaaatattgttgtgaaagctgacctt
gaactggattggttaaaacagaagggtgcagtgaaaagaacactttttatggaatcacac
caggcccaccattcttttgatctgatcatcaacaaacaaagattatcccagtgcttggac
ttccttgtttatctcagagaagaaagtgaattccgcgataagctcactccaatcagtgtc
aacttaaattacagtttggatgaatcggcttatctgggtgaccaggaactgaaaccgatc
ctcaatcgttacaagaaagcaaccattcaagaacaggcgcacattctagtggactgcgga
gaagacaacatgtgcattcctgatctcaagctctccgccagaccggacaagaatcagctt
gttattggagaagagaaccacattctgttcatcataaacacaaaaaaccaaggggaagga
gcttatgaagctgagctgcgcatgattatcccaccagaagctgattatgttggaattgag
cgcaacatggagggacttcggcaacttaactgtgaatataaaatggaaaatgaatctcga
ctggtggtatgcgatcttggcaaccctatggtggctggaacaaatctgtctgtcggtctg
agattcgttgtgcaacgattagaaaccgtagatgccatcacatttgatctctacattaaa
agttccaacaaggacaatccaaacagtaactttgtcagcttgcaagttaacataaccgct
gtggcccaagtagaaattagaggagtgtcccatcctcctcagatcattctacccattcct
aactgggagccgaaggagaaaccatctgaagaaaaggacgttgggccgttagtgcagcat
atatatgagctgcacaacattggcccgagtgctataagtgaaacacagctgaatgtggga
tggccttctcaaagccgagatgagtttctcctctatgtatttcacattcagactgagggt
cccctgaagtgccaggcaggaagtgccattaataccttaaatatcaaaccaagtgaacct
gaagatacccctgagcttgcagcttttctgaggaataccagtgtatctcatgcagtaagc
cgccgggatgtagctgtggcagaggcgctgaggcacattcccacaccgacaaaactactg
aattgcactaatgtgaaatgtttaatgatatcctgcaaagtcggccacttgggtggaggt
cagcgagcagtggtaaaaatccggtctcgtctgtgggctccaacattcttacagagaaaa
aatgattattactcacttattgccaatgtgtcatttgaagtcaagaagatgccttatgac
attcagccagccaagctcccagcagcaactatactgataaaaacatctgtgatctgggcc
acaccaaatatctcatttgccatccctctttgggtcatcttattggctatactccttggt
atactggttcttgccattctgacactggttatgtggaagtgcgggttcttcgacagagcg
aggcccccacaggatgacgttgcagatgacactcaacagttaacaaacaagacggcagaa
gcatga

DBGET integrated database retrieval system