KEGG   Xenopus tropicalis (western clawed frog): 100487624Help
Entry
100487624         CDS       T01011                                 

Gene name
itga8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100487624 (itga8)
   04514 Cell adhesion molecules (CAMs)
    100487624 (itga8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100487624 (itga8)
  Cellular commiunity
   04510 Focal adhesion
    100487624 (itga8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1081 aa AA seqDB search
MKLLSNTHSAAAASLLRALLPRHLYPQKMLSRWRPIAQQPACPMLMVIMLSGVCSAFNLD
VEKVTVYSGPPDSYFGYSVDFYLPDSAKTSILIGAPKANTSQPQIVEGGAVYYCPFPDTL
PTGCKQIPFDITNNRNIRLNGTKQPVEFKSNQWFGATVRAHKEKVVACAPLYHWRSIKPI
SEKDPVGTCYIAIQNFSAYAEYSPCRSDLADPAGQGVCQAGFSLDFYKNGDLALGGPGSF
YWQGQVFTASIADIIKDYSFKSIIRKISGEKQTKMAQSAYDDSYLGYSVAVGEFTDDSVQ
EVVAGVPRGAQNFGYVSIINSTDMTFIQNFTGDQMASYFGYTVAVSDVNNDGLDDILVGA
PLFMDREFESNPREVGKVYLYMQESALEFRDPQVLKGTEVFGRFGSAIAHLGDLNQDGYN
DIAVGSPFAGEDRKGRVFIYNGNSNGLNTDTSQILEGAWASQSMPAGFGFTLRGDSDIDK
NDYPDLIVGAFGAGKAVVYRARPVITVDAQLLLHPMILNPENKTCQLPNSEFLVTCFTVR
VCVTVSGQSIPSNIVVKADLELDWLKQKGAVKRTLFMESHQAHHSFDLIINKQRLSQCLD
FLVYLREESEFRDKLTPISVNLNYSLDESAYLGDQELKPILNRYKKATIQEQAHILVDCG
EDNMCIPDLKLSARPDKNQLVIGEENHILFIINTKNQGEGAYEAELRMIIPPEADYVGIE
RNMEGLRQLNCEYKMENESRLVVCDLGNPMVAGTNLSVGLRFVVQRLETVDAITFDLYIK
SSNKDNPNSNFVSLQVNITAVAQVEIRGVSHPPQIILPIPNWEPKEKPSEEKDVGPLVQH
IYELHNIGPSAISETQLNVGWPSQSRDEFLLYVFHIQTEGPLKCQAGSAINTLNIKPSEP
EDTPELAAFLRNTSVSHAVSRRDVAVAEALRHIPTPTKLLNCTNVKCLMISCKVGHLGGG
QRAVVKIRSRLWAPTFLQRKNDYYSLIANVSFEVKKMPYDIQPAKLPAATILIKTSVIWA
TPNISFAIPLWVILLAILLGILVLAILTLVMWKCGFFDRARPPQDDVADDTQQLTNKTAE
A
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgctcagtaacacacacagcgctgctgccgcctcactgctccgggctctcctt
ccgcgccacctttacccacagaagatgctgagccggtggcgccctatcgcccagcagcca
gcatgccccatgctcatggtgataatgctgagtggcgtttgttctgcctttaacctggat
gtagagaaagtgacagtgtacagcggccccccggatagttactttggctactctgtggac
ttctacttgcccgactcggcaaaaactagtattctcattggagcgcccaaagccaatacc
tctcagccacagatagtggaaggaggagccgtgtattactgtcccttccccgataccctg
cctactggatgcaagcagattccatttgatatcacaaacaacaggaacatcaggttaaat
ggaaccaaacagcctgttgaattcaagtcaaaccaatggtttggtgcaacagtcagggct
cataaggaaaaagttgtggcttgtgccccactgtatcactggagaagtattaagcccatt
tcagaaaaggatcctgttggcacttgctacattgccattcagaatttcagtgcttatgct
gaatactctccctgccgaagtgaccttgctgatcctgctggacaaggcgtctgtcaagct
ggcttcagtctggatttttataagaatggagacctggcgttgggagggcccggaagtttt
tactggcaaggacaagtctttactgccagtatagcagacataattaaagactattccttc
aagagcattatcaggaagatatcgggcgagaaacaaacaaaaatggcacaatctgcttac
gatgatagctacttaggatactctgtggctgttggagaatttactgatgattcagtgcaa
gaggtggttgccggagttccaaggggagcacaaaactttggatatgtctctatcatcaat
tcaactgacatgaccttcattcagaactttacaggtgaccagatggcctcttactttgga
tacactgttgctgtgtcagatgtaaacaatgacgggttggatgatatcttagttggagcc
ccacttttcatggatcgagaattcgagagcaatccaagggaggttggaaaagtctacttg
tacatgcaagaaagcgctcttgaatttagagacccccaagtactgaaaggcacagaagtc
tttgggagatttggtagtgctattgcccatttaggcgatcttaatcaagatggatacaat
gacattgcagttggctcaccatttgcgggggaagacagaaaaggcagagtgtttatctac
aatgggaacagcaatgggttaaacacagatacctcccagatactggaaggagcttgggcc
tcgcagtcaatgcctgctggatttggctttacgctgagaggcgattcagacatagacaaa
aacgattacccagatcttattgtgggagcttttggagcaggaaaagctgttgtttataga
gcgagaccagtgatcactgttgatgctcaacttttgctccaccccatgattctgaaccca
gagaataaaacctgccagctccccaattcagaatttctggtgacttgtttcactgtaaga
gtgtgtgtgactgtgtctgggcaaagcatcccttcaaatattgttgtgaaagctgacctt
gaactggattggttaaaacagaagggtgcagtgaaaagaacactttttatggaatcacac
caggcccaccattcttttgatctgatcatcaacaaacaaagattatcccagtgcttggac
ttccttgtttatctcagagaagaaagtgaattccgcgataagctcactccaatcagtgtc
aacttaaattacagtttggatgaatcggcttatctgggtgaccaggaactgaaaccgatc
ctcaatcgttacaagaaagcaaccattcaagaacaggcgcacattctagtggactgcgga
gaagacaacatgtgcattcctgatctcaagctctccgccagaccggacaagaatcagctt
gttattggagaagagaaccacattctgttcatcataaacacaaaaaaccaaggggaagga
gcttatgaagctgagctgcgcatgattatcccaccagaagctgattatgttggaattgag
cgcaacatggagggacttcggcaacttaactgtgaatataaaatggaaaatgaatctcga
ctggtggtatgcgatcttggcaaccctatggtggctggaacaaatctgtctgtcggtctg
agattcgttgtgcaacgattagaaaccgtagatgccatcacatttgatctctacattaaa
agttccaacaaggacaatccaaacagtaactttgtcagcttgcaagttaacataaccgct
gtggcccaagtagaaattagaggagtgtcccatcctcctcagatcattctacccattcct
aactgggagccgaaggagaaaccatctgaagaaaaggacgttgggccgttagtgcagcat
atatatgagctgcacaacattggcccgagtgctataagtgaaacacagctgaatgtggga
tggccttctcaaagccgagatgagtttctcctctatgtatttcacattcagactgagggt
cccctgaagtgccaggcaggaagtgccattaataccttaaatatcaaaccaagtgaacct
gaagatacccctgagcttgcagcttttctgaggaataccagtgtatctcatgcagtaagc
cgccgggatgtagctgtggcagaggcgctgaggcacattcccacaccgacaaaactactg
aattgcactaatgtgaaatgtttaatgatatcctgcaaagtcggccacttgggtggaggt
cagcgagcagtggtaaaaatccggtctcgtctgtgggctccaacattcttacagagaaaa
aatgattattactcacttattgccaatgtgtcatttgaagtcaagaagatgccttatgac
attcagccagccaagctcccagcagcaactatactgataaaaacatctgtgatctgggcc
acaccaaatatctcatttgccatccctctttgggtcatcttattggctatactccttggt
atactggttcttgccattctgacactggttatgtggaagtgcgggttcttcgacagagcg
aggcccccacaggatgacgttgcagatgacactcaacagttaacaaacaagacggcagaa
gcatga

DBGET integrated database retrieval system