KEGG   Xenopus tropicalis (western clawed frog): 100487665Help
Entry
100487665         CDS       T01011                                 

Definition
cytochrome P450 3A9-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xtr00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:xtr00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xtr00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 504 aa AA seqDB search
MNLIPHLSTGTWILLAVLLVLILLYGIWPYGLFKKMGIPGPTPLPFIGTFLEFRKGMIQF
DIECFKKYGRMWGMYDGRQPVLAIMDPAIIKTILVKECYTNFTNRRNFGLSGPLESAITS
AEDEQWKRIRSVLSPTFTSGKLKEMFQIMKDYSDILVKNVQVYVDKDEPCATKDVIGAYS
MDVITSTSFSVNIDSLQNPSNPFVIHIKNLLKTGLLSPVIILVVIFPFLRPIFEVLNISF
FPKNFTQFFMNAVTSFREKRKKGDHSGRVDLLQLMVDSGTTEGNDLSNQHKALTDAEIMA
QSVIFIFAGYETTSTALSYLFYNLATHPDVQQKLHEEIDSFLPDKASPTYDILMQMEYLD
MVIQETLRLFPPAGRLERVSKQNVEINGVSIPKGTVAMIPAYVLQRDPEYWPEPEEFRPE
RFSKENRATQTPFTFLPFGDGPRNCIGLRFALLSMKVAIATLLQNFSVRPCAETLIPMEF
STIGVLQPKKPIVLKFLSRAAAHE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcattcctcacctatcaacagggacatggattctccttgctgttttgttggtg
cttatattactatatggaatttggccatatggattgtttaagaaaatgggaattcctgga
cctactccattgcccttcataggaacatttctggagtttaggaaagggatgatacagttt
gatattgaatgcttcaagaaatatgggaggatgtggggaatgtatgatgggagacaaccc
gtgcttgcaattatggatcctgctataattaaaactattcttgtgaaagagtgttacaca
aatttcactaacagacggaattttggtttgtctggcccccttgagtctgccatcacttct
gcagaggatgaacagtggaaaaggattcgcagtgtgctatcacctacattcacaagtgga
aaattaaaagagatgttccagataatgaaagattactcagatatccttgtaaaaaacgtc
caggtttatgtggacaaagatgagccatgtgcaacgaaagatgtgattggagcatacagc
atggatgttatcactagcacttcattcagtgtgaatattgactcccttcaaaatccttca
aatccttttgttattcacataaagaatctgttgaaaactggcttgctgagcccagtgatc
atcttagtggtgatttttccattccttagacctatttttgaggtcctgaatataagcttt
tttccaaaaaatttcactcagttttttatgaatgctgtcacaagctttcgggaaaagaga
aaaaaaggagatcactcgggacgtgtggatttacttcaacttatggtggattcagggaca
acagaaggaaatgatttaagcaatcagcataaagctctgacagatgcagaaataatggct
cagtctgttatatttatattcgctggatatgaaaccacaagtacagcactgtcttacctg
ttctataatcttgccacccaccctgatgtccagcagaaactgcatgaggagatagattca
tttctccctgacaaggccagtcctacttatgacattctaatgcagatggaatatcttgat
atggttattcaggagacccttaggttgtttccccctgcgggacgactagaaagagtctca
aagcagaatgttgagattaatggtgttagcatccccaaggggacagtcgcaatgatccca
gcatatgtgctacaacgggaccctgaatattggccagagcctgaagagttccgccctgaa
aggttcagtaaagaaaacagggcaacacaaactccatttacctttctgccatttggagat
ggtcccaggaattgcattggattgagatttgctctcctgagcatgaaagtggccattgcc
accctgttacagaacttcagtgtccggccttgtgcagaaactctgattcccatggagttc
agcaccataggcgttttacagccaaagaaaccaattgttttaaaatttctctctcgggca
gcagctcatgagtaa

DBGET integrated database retrieval system