KEGG   Xenopus tropicalis (western clawed frog): 100487877Help
Entry
100487877         CDS       T01011                                 

Gene name
rxra
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100487877 (rxra)
   03320 PPAR signaling pathway
    100487877 (rxra)
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100487877 (rxra)
Nuclear receptors [BR:xtr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100487877 (rxra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 460 aa AA seqDB search
MDTKHFLPLDFSTQVNASSLNSSGLRGSMTAPLLHPSLGNSGINNSLGSPTQLHSPLNGM
GPPFSVISPPLGPSMPIPSTPGLGFGTGSPQIHSPMNSVSSTEDIKPPPGINGILKVPAH
PSGPMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDSKDCMIDKR
QRNRCQYCRYQKCLAMGMKREAVQEERQRGKERNENEVESSSSANEDMPVEKILDAEHAV
EPKTETYIEANMGLAPNSPSDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLR
AGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQM
DKTELGCLRAIVLFNPDSKGLSNPSEVEALREKVYASLEAYCKQKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaagcatttcctgccgctggatttttccacccaggtaaacgcctcgtcctta
aactcctcgggcctccgcgggtctatgactgcccctctgctccatccgtccctcggcaac
tctgggatcaacaactccctgggttcccccactcagctccactctcctctcaatggaatg
ggcccgcctttctccgttatcagcccgcccctggggccctccatgcccattccatccacg
cccggcctcggctttggaacaggcagccctcagatccattcccccatgaactcggtcagc
agcacagaagacatcaagcctcctccgggaatcaacggcatccttaaagtaccggcccat
ccctcaggacctatggcctctttcaccaagcacatctgcgccatctgcggtgacagatct
tcaggcaaacattacggggtttacagctgcgagggctgcaaggggtttttcaagcggacg
gtgcggaaggacctgacttacacctgccgggatagcaaggactgcatgattgacaagcga
cagcggaaccggtgccagtactgccggtaccagaaatgtctagcgatgggcatgaagaga
gaagccgtccaggaggagagacagagggggaaggaacgaaacgagaatgaggtggagagt
agcagcagtgccaacgaggacatgccggtggagaagatccttgatgcagagcacgcggtg
gaaccaaagactgagacatacatagaggcgaacatgggcctcgctcccaactctcccagt
gaccctgttaccaacatttgccaagcagcagacaagcaactcttcacactggttgaatgg
gcaaagagaatccctcatttctccgagctgcctctggacgaccaagttatcctacttagg
gcagggtggaacgagctccttattgcctcattttcacatcgttcaatagctgtcaaagat
ggaatcctcctcgccacgggccttcatgtacatcggaacagcgcacacagtgcaggagtc
ggtgcaatttttgatagggtcctcacagaactggtatccaaaatgagagacatgcagatg
gacaaaacagaactcggttgcttacgagccattgtcctcttcaacccagactcaaaaggt
ctctcgaacccctcagaggttgaggctctccgagagaaagtctatgcatcgttagaggcc
tactgcaaacagaaataccccgaacagcccgggaggtttgcgaaactcctcctacgcctg
ccagctctacgctccattggtctgaaatgcctggaacacctcttcttcttcaaactaata
ggagacacgcccatcgacactttcttaatggagatgctggaagcccctcaccaaatgact
taa

DBGET integrated database retrieval system