KEGG   Xenopus tropicalis (western clawed frog): 100487893Help
Entry
100487893         CDS       T01011                                 

Definition
cytochrome P450 2G1-like
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100487893
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100487893
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP2 family
   100487893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 976 aa AA seqDB search
MEFNSTLVLFLLFLITFMLMLSKKKHRGRLPPGPVPLPYIGNMHQVKINDLIKSLVDLSK
KYGPMYTFYLGSRPTVVLCGYQILKEALIDHAEEFSGRGEFPAVQMYSKGNERWRQLRRF
AITTLKNFGMGKRSLEERVKEEAQYLIAEFRNSEGEPFDPTFGFSSAGSNIICSLVFGDR
FDYRNPEFLNLLYLINNSWHLMSSTWGQLLFVFPKIMQLIPGPHKKIYKNYLKLGAFVAK
RLKMNKETLDPNNPRDFIDCFLIKIQQEKKNPDSHFNYETMLKTTVNVFFAGTETVGSTL
RYGFLILLKHPEVEEKVQGEIDKVIGRNRSPCMDDRSKMPYTEAVIYEILRFADIVPMSV
PHTVTRDIEFRGYTLPKGLNIMPLICTSQYDVTKFKNPASFDPAHFLDENMDFKKNEGFM
AFSAGKRICVGEGLAQMELFIFFTTILQNFKLKRLMDPKNIDITPESSGLGNIPRPYKLC
LIPRLEMFGVNSYTLVLVSICLIYMYLLHKQKGNLPPGPQGLPIWGNLHQLDTKDLVKSL
GDMSKIYGPVFTIHLGPKPNVVLYGYKAVKEALVEQADIFSGRGEFKVVHRFTKGNGLVF
SNGEKWKTLRRFALTTLRNFGMGKRGVEERIKEEAQFLMEAFKHTNQNPFDPTFFLSRAV
SNVICSIVFGDRFDYGDKRFLMLLSLINESFQLMSSQWGMFYNIFPGVMKYLPGPHNQIF
QNFEKIKLFLLEMLKRHEETFQQDSPRDLMDCFLLEIKKENGKPLSHFNIETLVMTSFTL
FFGGTETVSTTLRYGILILMKYTNITEKIQEEIDTVIGKDRFPTMDDRSRMPYTDAVIHE
IQRFASIIPLSLPHSVTQDTYFRGYKLPKGTNVIPVLSSVHTDPTKYKEPQGFNPHNFLD
ENNQFKNNEAFMPFSSGKRICIGESLARMELFIFFSTLLQNFTLQPTQNPERIDLKPRIS
GVGNVPTPYQLCAFPR
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggagttcaacagcaccttggtcttatttcttctcttccttataacattcatgctgatg
ctgtctaagaagaagcaccgtgggagacttccccctggcccagtgccacttccatatatt
gggaacatgcatcaggtcaagataaatgatcttatcaagtccctagttgatctaagcaag
aagtacgggccgatgtatactttttatttgggttcacgccctactgtggtgctgtgtggg
taccagatactgaaggaggctcttattgaccatgcagaagaatttagtggaagaggagaa
ttccctgcagttcaaatgtatagcaaaggaaatgagagatggaggcagcttaggaggttt
gctataactacactaaagaattttggaatggggaagagaagcctggaagagagagtgaag
gaagaggcacagtatttgatagcagaattcagaaatagtgaaggggagccctttgaccca
acatttggctttagctcagctggttctaacattatctgctccttggtgtttggagaccga
tttgactaccgaaatccagagtttttaaacttgctgtacctgattaacaacagctggcat
ttgatgagttccacctggggccagctgctctttgtattcccaaagatcatgcagttaatt
ccaggcccacacaaaaagatatacaagaattatttgaaactgggagcatttgtagccaag
aggcttaagatgaacaaagaaacacttgaccccaacaacccacgcgattttatagattgc
ttcctcatcaaaatccagcaggaaaagaaaaaccctgactctcattttaactatgagaca
atgctgaagacaacagtaaatgtgttttttgctgggacagaaacagtgggatctacattg
agatatggcttcctaattttactgaagcacccagaagtagaagaaaaagttcaaggagaa
atagacaaagtgattggccgaaatagaagcccgtgcatggatgacagaagcaagatgcct
tacactgaggctgttatctatgagattctgagattcgctgacattgtgcccatgagcgtc
ccacatactgtaactcgggatattgagtttcggggctatactctgccaaagggtctaaat
atcatgcccttgatctgcacttcccagtatgatgttacaaaatttaagaaccccgcctca
tttgaccctgctcacttcctagatgagaatatggatttcaagaagaatgagggtttcatg
gcattctcagcaggaaagcgaatctgtgtgggtgagggactagctcagatggagctgttt
atattttttacgaccatcctacaaaacttcaagctgaaacgactaatggaccccaaaaat
attgatattactcctgaaagcagtggcctaggaaacattccaagaccctacaaactgtgc
ctaatccctcgtctggaaatgtttggagtcaattcttacacattagtcttggtctccatc
tgccttatctatatgtatctgctccataagcaaaaaggaaatttgcctccaggtcctcag
ggtttgccaatatggggtaatcttcaccagttggataccaaagatctagtcaagtcactg
ggagatatgagcaagatctatgggccagtcttcaccatccatctaggaccaaagcccaac
gttgtcctctatggatacaaagctgttaaggaggcactggtggaacaagctgacattttc
agtggaaggggagaatttaaggtggtccacagattcaccaaaggaaatggacttgtcttt
tctaatggtgaaaaatggaaaaccctccgccgctttgctttaaccacattaaggaacttt
ggaatggggaaaagaggagtggaggaacgaataaaagaggaggcccagtttttaatggag
gcatttaagcatacaaatcagaatccatttgacccaacttttttcctgagccgtgcagtc
tccaatgtcatctgttcaattgtgtttggggaccggtttgattatggagacaagagattc
ctgatgcttctaagccttataaatgaaagctttcaacttatgagctctcagtggggaatg
ttctataacatattcccaggggttatgaaatatttaccaggaccacacaaccaaattttc
caaaattttgaaaaaataaaactctttctgctggaaatgttaaagagacacgaggaaaca
tttcagcaagacagccccagggaccttatggactgctttcttttagagataaaaaaagag
aatggaaaaccgttgagtcactttaacattgaaacgttggttatgaccagttttaccttg
ttctttggaggaacagagacagtcagcaccactctgagatacggaattcttatactgatg
aaatacacaaatattacagaaaaaatacaagaggaaattgacacagttattggaaaggac
cgctttccaacaatggatgatcgaagcaggatgccttacactgatgctgtcatacatgag
attcagcgtttcgccagcatcatcccattaagccttccgcattcagtcacacaggatacc
tattttagaggctacaagctacccaagggaacaaacgttattccagtcctttcctctgtt
cacacagaccctacaaagtataaagaaccacaaggatttaacccccacaattttctggat
gagaacaatcagtttaagaacaatgaggcttttatgccattctcctcaggaaaacgtata
tgtattggggagagcttagctcgcatggagcttttcatatttttctcaaccttactccaa
aattttacactccagcccactcagaatcccgaacgtattgatcttaaaccaaggataagt
ggcgttggtaatgtcccaactccatatcagctctgtgctttccctcgctag

DBGET integrated database retrieval system