KEGG   Xenopus tropicalis (western clawed frog): 100487918Help
Entry
100487918         CDS       T01011                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100487918
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP4 family
   100487918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 516 aa AA seqDB search
MASNLWEVLSSPGLPGNIYQFGQFAALLCLILLLLKACGLFIRWKSLKDALQNFPGPPKH
WLYGNANQFRNDGTDMDRILLWANKYPKAFPLWVGQFFASLVITNPEYAKAAFARSDPKT
PTGYDFLIPWIGKGLLVLSGDTWFQHRRLLTPGFHYDVLKPYAKLISDSTKVMLDKWVPF
SNKGEPVELFHHVSLMTLDSIMKCAFSYHSNCQTDNDNSYTKAVYDLSYLTHHRARTFPY
HNNLIYYLSPHGFLFRKACRIAHQHTDKVIKQRKTLLQNKEEFEKVKQKRHPDFLDILLC
ARDENGKGLSDEDLRAEVDTFMFEGHDTTASGISWILYCMAKYPEHQQKCREEIRDVLGE
KESFEWEDLNKIPYTTMCIKESLRLYPPVPAVSRELNKPITFSDGRSLPAGSVIFINIFC
IHRNPTVWKDPEVFDPLRFSSENSSKRHSHAFVPFAAGPRNCIGQNFAMNELKVAVALTL
NRYELSPDLSKAPLKSPQLVLRSKNGIHVYLKKASY
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatctatgggaagtgctgagttcccctgggctacctgggaatatttaccag
tttggtcagtttgctgcactgttgtgtctgattctgctgctgctaaaagcctgtgggcta
tttatcaggtggaaaagtctcaaggatgcattgcagaactttcctggtccccccaaacac
tggctgtatgggaatgcaaatcagttccgtaatgatgggacagatatggacaggattctc
ctatgggcaaataaatatcctaaagcgttcccattgtgggttggacaattcttcgccagc
ctagtcattactaacccagaatatgccaaagctgcgtttgccagatcagatcctaaaaca
ccaactggatatgattttctaatcccatggattggaaagggcttgcttgtcctgtcagga
gatacgtggttccagcaccgcaggcttctcacaccaggatttcactatgatgttctgaaa
ccttacgccaaactgatatcagattcaacaaaggtcatgttggataaatgggttccattt
tccaataaaggtgaaccagtggagcttttccaccatgtcagcctgatgacactcgacagc
atcatgaaatgtgcctttagctaccacagcaactgtcagactgacaatgataattcctac
acgaaggctgtatatgatctctcatacctgactcatcacagggcacgtacctttccttat
cacaataacctaatttactatctcagtccccatggattccttttccgtaaagcctgcaga
atagctcaccagcacacagataaggttattaagcagagaaaaaccttgctacagaataag
gaggagtttgagaaagtcaagcagaagcgccatccagatttcctggacatccttctttgc
gccagggatgaaaatgggaagggtctatctgatgaggatctccgtgcagaggtggacaca
ttcatgtttgagggccatgacacaacagccagtgggatctcttggatcttatactgtatg
gccaaatacccagagcaccagcagaaatgtcgtgaggagatcagagacgtacttggagaa
aaggagtcttttgaatgggaggatcttaacaaaataccctataccacaatgtgcatcaag
gagagtctccgtctttatcctccagttccagctgtgtcaagggaactaaacaaaccaatt
acattctctgatggacggtccttacctgctggctctgtcattttcataaacattttctgc
attcatcggaatcccacagtatggaaagatccagaggtctttgacccactccggttttcc
tcagaaaactcttcaaagcggcactcccatgcatttgttccttttgctgctggaccaaga
aactgcattggacaaaactttgctatgaacgaacttaaagtggccgtggccctaacatta
aaccgttatgaactgtcgccagatctgtccaaggcaccgctcaaatcaccacaactggtc
ctgcgttccaaaaacggcatccatgtgtacctaaagaaagcaagctattaa

DBGET integrated database retrieval system