KEGG   Xenopus tropicalis (western clawed frog): 100488582Help
Entry
100488582         CDS       T01011                                 

Gene name
tgfbr2
Definition
transforming growth factor, beta receptor II (70/80kDa)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:xtr04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:xtr04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:xtr04144]
Cellular Processes; Cell communication; Adherens junction [PATH:xtr04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 718 aa AA seqDB search
MCHPLTNDLFGHKLKILNRNRCVMQKRKSSGETLYICACSDEECNDQIVFTDDKVTNMNT
DQKPQPVIPNDGNHPGSGVRNKVPVLCKSCDVRQTACADEGLCTSTCETTIKCEAEEVCV
AIWRNNNGSLTEQLLCHNPAQKLYGHILDDHVSSKCFMKEKEMSGENMLMCSCDTNECNS
EFYIGTSSKPSIWVPHVLCRFCDVKETTCENQGYCTSVCNIASVCEHQEEVCIAIWRNKD
GNITEETMCHDPKKELYGYKLDDYNEKECIMKEKKTSEGIMSMCSCRGKLCTERFYFPPA
NETNIDPSKDILLKVLLITLLPLVWITIAVIVGFYFYRVQRTKKLKKKWEKNPKCMRHPD
MDCSDACAIMIDDDRSDISSTCANNLNHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSE
QYETVAVKIFHFEEYASWKMEKDIFSDMNLKHENVLQFLTAEERKTDTGKQYWLITAFHS
KGNLQEYLSKHIISWEDLMKLGGSLARGVAHLHSDHTPCGRPKTPIVHRDIKSSNILVKN
DLTCCLCDFGLSLWLEPSLSVDDLANSGQVGTARYMAPEVLESRINLENIESFKQTDVYS
MALVLWEITSRCNAIGDVKDYEPPFGTKVREHPCVESMKDNVLRDRGRPEISNSWLSHQG
IQLVCETITECWDQDPEARLTAQCVEERFSEMETLDRLSERSCSEEKIPEDCSENASK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaccctttaacaaatgatctgtttggccacaagctgaaaatcctcaatcggaat
agatgtgttatgcagaaaagaaagtcttctggggaaactctgtacatttgtgcatgttcg
gatgaggagtgcaatgaccaaatagtcttcacagatgacaaagttacaaatatgaataca
gaccaaaaacctcaacctgtgataccaaatgatggaaaccatccaggcagtggagttcgt
aataaagtacctgttttatgcaagtcatgtgatgtgagacagacagcatgtgcagatgaa
ggcttgtgcactagcacatgcgaaactaccataaagtgtgaagctgaagaagtttgtgtg
gctatatggagaaataacaacggcagccttactgaacagttattatgccataacccagca
cagaagctgtatgggcacattttggatgatcatgtctcctcaaagtgtttcatgaaagaa
aaggagatgagtggtgaaaacatgttaatgtgctcctgtgataccaatgaatgcaatagt
gaattctacataggcactagttccaaacctagtatatgggttccacacgttttgtgtagg
ttttgtgatgtgaaagagacaacatgcgaaaaccaaggctactgtaccagtgtgtgcaac
atagcctccgtttgtgagcaccaagaagaagtgtgcatagctatatggaggaataaggat
ggcaacatcaccgaggaaacaatgtgtcatgacccaaaaaaggaactgtatggctataaa
ctggatgactataatgagaaagagtgcatcatgaaggagaaaaagacaagtgagggaata
atgtccatgtgttcgtgtagaggaaaactttgtactgagagattttattttcctccagca
aatgagacaaatatagacccatctaaagacatactcctgaaagttcttctcatcactctt
cttccactggtctggatcaccattgcagtcatcgtcggcttctacttctaccgtgttcag
agaacaaagaaactgaaaaagaaatgggaaaagaatccaaagtgcatgcgccatcccgat
atggactgcagcgatgcctgtgcgattatgatagacgatgatcgttctgacatcagttca
acatgtgccaacaacctaaaccacaatactgagcttctcccaattgaattagacactttg
gttgggaaaggtcgatttgctgaagtgtacaaggccaagctaaaacaaaatacatcagaa
cagtatgaaacagtggctgtcaaaattttccattttgaagaatatgcatcttggaagatg
gaaaaagatattttttctgacatgaatctgaaacatgagaacgtactgcagttcctgaca
gcagaagagaggaaaactgacactggcaaacagtattggctcatcactgctttccactct
aaaggcaatctacaagaatatttatccaagcatatcatcagctgggaagaccttatgaag
cttggaggctctttggcccgtggcgttgctcatttgcacagtgatcacacaccctgtggc
agaccaaagacaccaattgttcaccgcgacattaagagctcaaatattttggttaaaaat
gatctcacatgttgcttgtgtgacttcggtctgtctctttggcttgaaccttcactttca
gtggatgatcttgcaaacagtggccaggtcggaactgctaggtatatggctccagaggtt
ctagagtctagaatcaatctggagaacatagaatcatttaagcaaactgatgtttattca
atggcgcttgtcctttgggaaatcacatcccgctgcaatgccattggagatgtaaaggac
tacgagcctccatttggcacaaaagtgcgggagcacccatgtgttgaaagcatgaaggac
aatgtattgagggatagagggagacctgaaatctccaacagctggcttagccatcagggg
atccagcttgtatgtgagactataacagaatgttgggaccaagacccagaagcccgtctc
actgctcagtgtgtagaggaaaggttcagtgaaatggagaccctcgacagactctcagag
agaagctgttctgaagagaagataccagaggactgttcagagaatgcaagcaaatag

DBGET integrated database retrieval system