KEGG   Xenopus tropicalis (western clawed frog): 100488600Help
Entry
100488600         CDS       T01011                                 

Gene name
rarb
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100488600 (rarb)
Nuclear receptors [BR:xtr03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100488600 (rarb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 447 aa AA seqDB search
MFDCMDVLAVSPGQMLDFYTASPSSCMLQEKALKACFNGLAQTDWQHRHSAQSIETQSTS
SEDLVPSPPSPPPPPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRE
KNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDRNKKKKEPSKIECIENYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSAEQRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICEDRQDLEEPAKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKLEIPGSMPPLIQEMLENSEGHEASASSP
SEDKTEHSHCISPSSEEECVSKCAQVQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgcatggatgttctggcagtgagtcctgggcaaatgctggatttctacact
gcgagcccgtcttcctgcatgctccaggagaaagctctgaaagcatgcttcaatggattg
gcacagacggattggcaacaccggcacagtgctcaatctattgaaacccagagcacgagt
tcagaagacctggtaccaagtccgccatcaccacccccaccacctcgaatttacaagccc
tgttttgtctgtcaggataagtcatctgggtatcactatggagtcagtgcatgtgaggga
tgcaagggtttcttccggcggagtattcagaaaaacatggtatatacttgtcacagagaa
aagaactgcgttatcaataaagttacaaggaatcgttgccagtactgcaggctacagagg
tgctttgaagtgggcatgtccaaagaatccgtcagaaatgacagaaacaagaaaaagaaa
gagccttcaaagatagagtgcatagaaaactacgagatgacagcagagctagatgacctg
acagagaaaatcagaaaagctcatcaagagacctttccctcgctatgtcagctgggaaaa
tacactacgaactccagcgcagagcagcgcgtccggctagatcttggactttgggacaaa
tttagcgaacttgctacaaagtgcattattaaaatagtggaatttgcaaaacgcttacct
ggattcaccagtctgaccatagcagatcagatcacactacttaaagctgcttgtctggat
attttgattctccgaatttgcacaagatacacaccagagcaggatactatgactttctca
gatggccttactctcaaccgaactcagatgcacaatgctggatttggtccactcactgac
ctcgtgttcacgtttgccaatcaactcctgcccttggaaatggatgacacagaaactggc
ctgctcagtgccatctgcttaatttgtgaagatcgccaggatctggaagagccggcaaag
gtggacaaactgcaagagccgctgctggaagcgctgaaaatttatatcagaaaaaggagg
cccaacaagccacacatgtttccaaagattctaatgaagatcacagatctccgcagcatt
agtgcaaaaggtgcggaacgtgttattactctgaagctggaaattcctgggtcaatgccg
ccgctcattcaggagatgttggagaactcggaggggcacgaagcttcagcaagcagtccg
agcgaggacaaaacagagcacagtcactgcatctcgcccagctcagaggaggaatgtgtc
agcaaatgtgcacaggttcaatag

DBGET integrated database retrieval system