KEGG   Xenopus tropicalis (western clawed frog): 100488600Help
Entry
100488600         CDS       T01011                                 

Gene name
rarb
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 447 aa AA seqDB search
MFDCMDVLAVSPGQMLDFYTASPSSCMLQEKALKACFNGLAQTDWQHRHSAQSIETQSTS
SEDLVPSPPSPPPPPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRE
KNCVINKVTRNRCQYCRLQRCFEVGMSKESVRNDRNKKKKEPSKIECIENYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSAEQRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICEDRQDLEEPAKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKLEIPGSMPPLIQEMLENSEGHEASASSP
SEDKTEHSHCISPSSEEECVSKCAQVQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgcatggatgttctggcagtgagtcctgggcaaatgctggatttctacact
gcgagcccgtcttcctgcatgctccaggagaaagctctgaaagcatgcttcaatggattg
gcacagacggattggcaacaccggcacagtgctcaatctattgaaacccagagcacgagt
tcagaagacctggtaccaagtccgccatcaccacccccaccacctcgaatttacaagccc
tgttttgtctgtcaggataagtcatctgggtatcactatggagtcagtgcatgtgaggga
tgcaagggtttcttccggcggagtattcagaaaaacatggtatatacttgtcacagagaa
aagaactgcgttatcaataaagttacaaggaatcgttgccagtactgcaggctacagagg
tgctttgaagtgggcatgtccaaagaatccgtcagaaatgacagaaacaagaaaaagaaa
gagccttcaaagatagagtgcatagaaaactacgagatgacagcagagctagatgacctg
acagagaaaatcagaaaagctcatcaagagacctttccctcgctatgtcagctgggaaaa
tacactacgaactccagcgcagagcagcgcgtccggctagatcttggactttgggacaaa
tttagcgaacttgctacaaagtgcattattaaaatagtggaatttgcaaaacgcttacct
ggattcaccagtctgaccatagcagatcagatcacactacttaaagctgcttgtctggat
attttgattctccgaatttgcacaagatacacaccagagcaggatactatgactttctca
gatggccttactctcaaccgaactcagatgcacaatgctggatttggtccactcactgac
ctcgtgttcacgtttgccaatcaactcctgcccttggaaatggatgacacagaaactggc
ctgctcagtgccatctgcttaatttgtgaagatcgccaggatctggaagagccggcaaag
gtggacaaactgcaagagccgctgctggaagcgctgaaaatttatatcagaaaaaggagg
cccaacaagccacacatgtttccaaagattctaatgaagatcacagatctccgcagcatt
agtgcaaaaggtgcggaacgtgttattactctgaagctggaaattcctgggtcaatgccg
ccgctcattcaggagatgttggagaactcggaggggcacgaagcttcagcaagcagtccg
agcgaggacaaaacagagcacagtcactgcatctcgcccagctcagaggaggaatgtgtc
agcaaatgtgcacaggttcaatag

DBGET integrated database retrieval system