KEGG   Xenopus tropicalis (western clawed frog): 100488677Help
Entry
100488677         CDS       T01011                                 

Gene name
plcd1
Definition
phospholipase C, delta 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:xtr00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:xtr04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:xtr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 784 aa AA seqDB search
MQCVRRQPSRSKSQELEQEEGRRQEAQLNSKQLGLQDDEDLRVLLKGSNLFKLKSESWKK
ARFYKLQEDCKTVWYDSKKFFKSQESQAFSVDDIEDVRTGHQTEEMQRFAAGTPPDLCFS
IIFKGQRKNLNLIATDEKEAAHWVSGFNKILATSKAMNQTQKVQHWIHSCLRKADKDKDN
RMTLKELKGFLQEVNIETDESYAKQIFQHCDKSQSGTLEGEEIEEFYKILTEREEIDVIF
ATYADGGNFMSSDNLIRFLQQEQRESAGAEYAKSLIDKYEPSEQAKKQEAMTKDGFLIYL
LSDDGNLFNAAHRKVYQDMKQPLSHYFISSSHNTYLMEDQLAGPSSTEAYIRALSKGCRC
VELDCWDGPNSEPIIYHGYTLTSKILFKDVIAAIKKYAFKTSPYPVILSLENHCTLEQQI
KMANHMKSILGDMLLLAPLEGKLKEFPSPEELKGKILVKGKKLNKLEESVRRQSGNGGAE
AEDVSDEDEAAEMADEAVRSKVQEAKRKAKLKLAKELSDTVVYCKSVHFGGFDYALEHQS
FYEMSSLAEDKALKLANDSGNKFIKHNTRQLTRIYPDGFRTDSSNYGPVELWNVGCQIVA
LNFQTPCPEMDLYQGRFQDNGACGYVLKPQFLRQSDSRFNPRSIQDGEWWTPKKLHIMVI
SGQQLPKVNKKPSSIVDPVIRMEIHGVERDKGHKHTQVMKNNGFNPTWNENFEFEIDVPA
LAVLRVVVEDHDAATRNDFIGQFTVPLTSLKLGYRHIHLLSKSGDQYPSATLFVHAMLVE
PSKS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgtgtgcgcaggcagccgtcccgatccaagtcccaggagctggagcaggaggag
ggccgcaggcaggaggcgcagctcaactccaagcagctggggctgcaagatgacgaggat
ttgagggttcttctgaaaggcagcaatctgttcaagttaaagtcagaatcatggaaaaaa
gcaaggttttacaaactgcaagaagactgcaagacggtttggtatgattccaaaaagttt
ttcaagtcccaggaatcacaggcattctcggttgatgacattgaagatgttcggacgggg
caccagacggaggagatgcagagattcgctgccgggacgccgcccgacctctgcttctcc
atcatctttaagggccaacgcaagaacctcaacctgatagccaccgacgagaaggaggcg
gcccattgggtctccggcttcaataagatcctggccacctccaaggccatgaaccagact
cagaaggtgcaacactggatccactcgtgcctgaggaaggcggataaggacaaggataac
aggatgaccctgaaggaactcaagggcttcttgcaagaagtgaatatcgagacggacgag
agctacgccaagcagatcttccagcactgtgacaagtcccagtcggggaccctggagggg
gaggagatcgaggaattctacaagatcctgaccgagcgggaagagatcgatgtcatattc
gccacctacgccgacggcggcaacttcatgtcgagtgacaacctgatccggttcctccag
caggaacagcgggaaagcgccggcgccgagtatgccaagtccctcatcgacaagtacgag
cccagcgagcaggccaagaagcaagaggcaatgaccaaggacgggttccttatttacctg
ctgtcggacgatgggaatctctttaacgccgcgcaccggaaggtctatcaggacatgaag
cagcccctcagccattactttatctcctcctcccacaatacctacctgatggaagaccaa
ctggcaggcccaagcagtacggaggcctacattagggcgctgtcgaagggctgtcgctgc
gtagaactggactgctgggacggccctaactcagagcccattatctatcacggttacacc
ctcacgtccaagatcctcttcaaagatgtcatagcagccattaagaagtatgccttcaaa
acttctccttaccctgtgatcctctcgctggagaaccactgcaccctggaacagcaaatc
aaaatggccaaccatatgaaaagcattctgggagatatgctcctgctggcgccgctcgag
gggaagctgaaggagttcccatccccagaggagctgaagggtaaaatcctggtgaagggg
aagaagctgaataaactggaggagagtgtgaggcggcagagcggcaatgggggggcggag
gccgaggatgtgtccgatgaggacgaggcggcggaaatggcggatgaagctgtcagatcc
aaagtgcaggaggccaagaggaaggccaagctgaaactggccaaggagctgtcggacacg
gtcgtgtactgtaagagcgtgcacttcgggggcttcgactacgcgctggagcaccagtcc
ttctacgagatgtcgtccctcgccgaggacaaagccctgaagttggccaatgactcagga
aacaaattcatcaagcacaacacaaggcagctgacccggatctaccccgacggctttagg
accgactcgtccaactacggcccagtggaattgtggaacgtgggctgccagatcgtggct
ttaaatttccagaccccctgcccagagatggacttgtatcagggccgcttccaggacaac
ggggcctgcggttacgtccttaagccccagttcctcaggcagtcggactccaggttcaat
cccaggtccatccaagatggagaatggtggaccccaaagaagctgcatattatggtgatc
tctgggcagcagttaccgaaggtgaacaagaagccgagctccatcgtggatccggtgatc
agaatggagatacacggggtggaacgggataagggccacaaacacacgcaggtcatgaag
aataacgggttcaacccaacgtggaacgagaactttgagtttgaaattgacgtcccggcg
ctcgctgtgctgcgcgttgtggtggaagaccatgacgcagcgacgcgcaacgacttcatt
ggccagtttacggtgcctctgaccagtctgaaactgggttaccgccacatccacctgctg
tccaagagcggcgaccaatacccctcggccacgctgtttgtgcacgccatgctggtcgag
ccgagcaaatcctga

DBGET integrated database retrieval system