KEGG   Xenopus tropicalis (western clawed frog): 100488677Help
Entry
100488677         CDS       T01011                                 

Gene name
plcd1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100488677 (plcd1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100488677 (plcd1)
   04070 Phosphatidylinositol signaling system
    100488677 (plcd1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100488677 (plcd1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100488677 (plcd1)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100488677 (plcd1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100488677 (plcd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 784 aa AA seqDB search
MQCVRRQPSRSKSQELEQEEGRRQEAQLNSKQLGLQDDEDLRVLLKGSNLFKLKSESWKK
ARFYKLQEDCKTVWYDSKKFFKSQESQAFSVDDIEDVRTGHQTEEMQRFAAGTPPDLCFS
IIFKGQRKNLNLIATDEKEAAHWVSGFNKILATSKAMNQTQKVQHWIHSCLRKADKDKDN
RMTLKELKGFLQEVNIETDESYAKQIFQHCDKSQSGTLEGEEIEEFYKILTEREEIDVIF
ATYADGGNFMSSDNLIRFLQQEQRESAGAEYAKSLIDKYEPSEQAKKQEAMTKDGFLIYL
LSDDGNLFNAAHRKVYQDMKQPLSHYFISSSHNTYLMEDQLAGPSSTEAYIRALSKGCRC
VELDCWDGPNSEPIIYHGYTLTSKILFKDVIAAIKKYAFKTSPYPVILSLENHCTLEQQI
KMANHMKSILGDMLLLAPLEGKLKEFPSPEELKGKILVKGKKLNKLEESVRRQSGNGGAE
AEDVSDEDEAAEMADEAVRSKVQEAKRKAKLKLAKELSDTVVYCKSVHFGGFDYALEHQS
FYEMSSLAEDKALKLANDSGNKFIKHNTRQLTRIYPDGFRTDSSNYGPVELWNVGCQIVA
LNFQTPCPEMDLYQGRFQDNGACGYVLKPQFLRQSDSRFNPRSIQDGEWWTPKKLHIMVI
SGQQLPKVNKKPSSIVDPVIRMEIHGVERDKGHKHTQVMKNNGFNPTWNENFEFEIDVPA
LAVLRVVVEDHDAATRNDFIGQFTVPLTSLKLGYRHIHLLSKSGDQYPSATLFVHAMLVE
PSKS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgtgtgcgcaggcagccgtcccgatccaagtcccaggagctggagcaggaggag
ggccgcaggcaggaggcgcagctcaactccaagcagctggggctgcaagatgacgaggat
ttgagggttcttctgaaaggcagcaatctgttcaagttaaagtcagaatcatggaaaaaa
gcaaggttttacaaactgcaagaagactgcaagacggtttggtatgattccaaaaagttt
ttcaagtcccaggaatcacaggcattctcggttgatgacattgaagatgttcggacgggg
caccagacggaggagatgcagagattcgctgccgggacgccgcccgacctctgcttctcc
atcatctttaagggccaacgcaagaacctcaacctgatagccaccgacgagaaggaggcg
gcccattgggtctccggcttcaataagatcctggccacctccaaggccatgaaccagact
cagaaggtgcaacactggatccactcgtgcctgaggaaggcggataaggacaaggataac
aggatgaccctgaaggaactcaagggcttcttgcaagaagtgaatatcgagacggacgag
agctacgccaagcagatcttccagcactgtgacaagtcccagtcggggaccctggagggg
gaggagatcgaggaattctacaagatcctgaccgagcgggaagagatcgatgtcatattc
gccacctacgccgacggcggcaacttcatgtcgagtgacaacctgatccggttcctccag
caggaacagcgggaaagcgccggcgccgagtatgccaagtccctcatcgacaagtacgag
cccagcgagcaggccaagaagcaagaggcaatgaccaaggacgggttccttatttacctg
ctgtcggacgatgggaatctctttaacgccgcgcaccggaaggtctatcaggacatgaag
cagcccctcagccattactttatctcctcctcccacaatacctacctgatggaagaccaa
ctggcaggcccaagcagtacggaggcctacattagggcgctgtcgaagggctgtcgctgc
gtagaactggactgctgggacggccctaactcagagcccattatctatcacggttacacc
ctcacgtccaagatcctcttcaaagatgtcatagcagccattaagaagtatgccttcaaa
acttctccttaccctgtgatcctctcgctggagaaccactgcaccctggaacagcaaatc
aaaatggccaaccatatgaaaagcattctgggagatatgctcctgctggcgccgctcgag
gggaagctgaaggagttcccatccccagaggagctgaagggtaaaatcctggtgaagggg
aagaagctgaataaactggaggagagtgtgaggcggcagagcggcaatgggggggcggag
gccgaggatgtgtccgatgaggacgaggcggcggaaatggcggatgaagctgtcagatcc
aaagtgcaggaggccaagaggaaggccaagctgaaactggccaaggagctgtcggacacg
gtcgtgtactgtaagagcgtgcacttcgggggcttcgactacgcgctggagcaccagtcc
ttctacgagatgtcgtccctcgccgaggacaaagccctgaagttggccaatgactcagga
aacaaattcatcaagcacaacacaaggcagctgacccggatctaccccgacggctttagg
accgactcgtccaactacggcccagtggaattgtggaacgtgggctgccagatcgtggct
ttaaatttccagaccccctgcccagagatggacttgtatcagggccgcttccaggacaac
ggggcctgcggttacgtccttaagccccagttcctcaggcagtcggactccaggttcaat
cccaggtccatccaagatggagaatggtggaccccaaagaagctgcatattatggtgatc
tctgggcagcagttaccgaaggtgaacaagaagccgagctccatcgtggatccggtgatc
agaatggagatacacggggtggaacgggataagggccacaaacacacgcaggtcatgaag
aataacgggttcaacccaacgtggaacgagaactttgagtttgaaattgacgtcccggcg
ctcgctgtgctgcgcgttgtggtggaagaccatgacgcagcgacgcgcaacgacttcatt
ggccagtttacggtgcctctgaccagtctgaaactgggttaccgccacatccacctgctg
tccaagagcggcgaccaatacccctcggccacgctgtttgtgcacgccatgctggtcgag
ccgagcaaatcctga

DBGET integrated database retrieval system