KEGG   Xenopus tropicalis (western clawed frog): 100488713Help
Entry
100488713         CDS       T01011                                 

Gene name
egr3
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100488713 (egr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 380 aa AA seqDB search
MTGKLLDKLQVNMTSLLPDSLYPEEGQDLSGSLAIYPGGNDQHYPVMSTDNVIDLGLNND
KNSQDLSYNGTFQPGNKTVTYLGKFSFDSPSSWCQENIISLMSSGILGVQTSQAPNGGGT
GNGGGNGGLMGQNQNDVESMFHGLPSYAGCGDLYHEQVGFQGGGMAPYTSQDYSSAKQSL
DSGVFPMIPDYNLFHHNTEMPPVDQKPFQNMEAIRVNPPPITPLETIKAFKEKQVLPSFG
GMGHQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHK
PFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAKIHLKQKDKKG
GDKAVCSPSVGGAPVVTTCA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgactggcaagctgttggacaagctacaagtgaacatgacctctctgctgccggattcc
ctgtaccccgaagaggggcaggatctgtctggatctctagccatctaccctggtggcaac
gatcagcactatccggtcatgtctacagataatgtgattgacttgggcttgaacaatgac
aagaactcccaggatctctcctacaatggcacgtttcagccaggtaataagactgtcacc
tatttgggcaagttttcctttgactcaccctccagttggtgccaggagaacataattagc
ctcatgagctccggcatccttggcgtgcagacttcacaagcaccaaatggcggaggaact
ggaaacggtggaggtaacggtggccttatgggacaaaatcaaaatgatgtggaatctatg
ttccatggtttaccatcatatgctggctgtggtgacctataccatgagcaagtgggcttc
caaggaggtggcatggcaccctacacctctcaggattactcatctgccaaacagagcttg
gactctggtgttttccctatgataccagactataatttgttccatcacaacacagagatg
cctccagtggaccaaaagccttttcagaatatggaggctataagggtcaatccaccacct
ataacaccactggaaaccattaaggcatttaaggaaaagcaggttttgcccagctttgga
ggcatgggccaccaaccacctctaaccctgaaacccatccgtcccagaaagtaccccaac
cgtcctagtaaaacccctctccatgaaaggcctcatgcctgccctgcagaaggctgtgac
cgtcgtttttcgcgctcagatgagctcactcgccatctgcgtatccacacgggacacaag
ccctttcagtgtcgcatctgtatgcggagcttcagccgctctgaccacctcaccacccac
attcgcactcacactggggaaaagcccttcgcttgtgatttctgtggacgcaaatttgca
cgtagtgatgagaggaaaaggcatgcaaagattcatctcaagcagaaagataagaaggga
ggggacaaggctgtctgctcaccttctgtgggtggggcaccagtggtaaccacctgtgct
taa

DBGET integrated database retrieval system