KEGG   Xenopus tropicalis (western clawed frog): 100488833Help
Entry
100488833         CDS       T01011                                 

Gene name
bpnt1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xtr00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 329 aa AA seqDB search
MLCTSLHLLRSSWSNQRAAFIMASSPDLLMKLVASAYSVAEKAGTIVRNVMSAGDLGIVE
KTGANDLQTAADRLVQQSICSSLAKKFPKLTIIGEEDLPSEEVEDSLLALGQSEDILKHT
CPSQYSGIKEEEIVVWVDPLDGTKEYTEGLLDHVTVLIGIAYGGKAIAGVINQPYYNYQA
GNNAVLGRTIWGVLGIGAFGFELKEAPAGQHIITTTRSHSSKLVNDCIAAINPDKVVRVG
GAGNKIIQLIEGQASAYVFASPGCKKWDTCAPEAILHAVGGQLTDIHGNPFQYQKDVKHM
NSAGVLAALRNFDYYFSRVPDSVKQALVP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtacctcattgcacttactgagatcaagttggagcaaccagcgtgcagcattt
atcatggcttcctctcctgatttactgatgaagctggtggcgtctgcctattctgtagca
gagaaagctggaacaatagtcaggaatgtgatgagcgccggagacttgggtatagtggaa
aagacaggagcaaatgacctgcagaccgccgctgatcgcctggtgcaacagagtatatgt
tcatccctagcaaagaaattccccaagttgaccatcatcggggaggaggatctgccttct
gaggaagtggaagacagcctgcttgcactggggcaatctgaggacattctcaagcatacc
tgcccctcacagtacagtggcatcaaagaagaagagatcgtggtgtgggtagatcctctg
gatggcacaaaagaatacacagaaggtttgctggaccatgtgactgtgctaattggaatt
gcttatggaggaaaggccattgctggggtgataaaccagccatattataactaccaggct
ggtaacaatgcagtgcttggcagaacaatctggggagttctgggcatcggtgcctttggc
tttgagctgaaagaagcgcctgctgggcagcatatcatcaccaccacgcgctctcacagc
agcaagcttgtgaatgactgtatagctgccatcaacccagataaggtggttcgagtgggt
ggagcaggaaataagatcatacagcttatcgagggccaggcatcggcctatgtgtttgcc
agtcctggctgcaagaaatgggacacctgcgctccagaagctattctgcatgcagtagga
ggccagctcaccgatattcatggaaacccattccagtaccaaaaggatgtgaaacacatg
aactcagcaggcgtgttggctgctctgcgcaatttcgactattacttctcccgtgtccct
gattctgtgaaacaagcgctggtgccttaa

DBGET integrated database retrieval system