KEGG   Xenopus tropicalis (western clawed frog): 100488927Help
Entry
100488927         CDS       T01011                                 

Gene name
kat2b
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100488927 (kat2b)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100488927 (kat2b)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100488927 (kat2b)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100488927 (kat2b)
   HAT complexes
    PCAF complex
     100488927 (kat2b)
    STAGA complex
     100488927 (kat2b)
    TFTC complex
     100488927 (kat2b)
    SAGA complex
     100488927 (kat2b)
    SLIK complex
     100488927 (kat2b)
    ADA-HAT complex
     100488927 (kat2b)
    HAT-A2 complex
     100488927 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 816 aa AA seqDB search
MSEAASGGGTMVCVAGSGSSALPQGSPAIVASAASGAARGAESPSAAGGGGVGSAPLRIA
AKKGQLRSAPRAKKLEKLGVYSACKADETCKCNGWKNPNPPPTPPKMDLQQTVVSLAEPC
RSCGHTLAAHVSHLENVSEEEMNRLLGIVLDIEYLFTCVHKEEDADTKQVYFCLFKLLRK
CILQMVKPAVEGSLGSPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIIELAKMFLNRINY
WHLETPSQRRLRSPNDDIAGYKENYTRWLCYCNVPQFCDSLNRYETTQVFGRTLLRSVFT
VMRRQLLEQARQEKDKLPQEKRTLILTHFPKFLSMLEEEVYSSNSPIWDEDFMSASSQTN
LDLGIQAVISAPPVTMSVAYAASPSSLEQSSSGSLSPSGKPACALETNLGIKRKSSEPFA
AEDAKKPRVVGDIPIELIHEVMSTITDPTAMLGPETSFLSAISARDEAARLEERRGVIEF
HVVGNSLNQKPNKKIMIWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIG
GICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNVLNFLTYADEYAIGY
FKKQGFSKDIKVPKARYVGYIKDYEGATLMGCELNPKIPYTEFSVIIKKQKEIIKKIIER
KQAQIRKVYPGLSCFKEGVRQIPIESIPGIRETGWKPSIKERSKEPKDPDQLYNILKTIL
QQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERVKNKYYVTKKLFMADLQRIF
TNCREYNPPESEYFKCANILEKFFYSKIKEAGLIDK
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggctgcatcgggcggagggaccatggtgtgtgtagccggttctggcagtagc
gcactacctcagggatccccggccatagtggcttcagctgcctcaggagcagcccgcggt
gccgagagcccatcagctgccgggggaggaggtgttggatctgcgccgctcaggatcgct
gccaagaagggacagttgcgctcggctccccgggccaagaaactggagaaactcggagtg
tactctgcctgcaaggcagatgaaacatgtaagtgcaatggctggaaaaaccctaaccct
cctccaacaccccctaagatggatctccagcagacagttgtcagcctcgctgagccatgt
cgaagctgcggccatacccttgctgcgcatgtatctcatttggagaatgtgtcggaagaa
gaaatgaaccgtctcctggggattgtattggacattgaatatttattcacatgtgtgcac
aaagaggaagatgctgataccaaacaagtttatttctgcttatttaagcttttgaggaag
tgtatcctgcaaatggtgaaacctgcagtggaaggatcattgggttcccctccatttgag
aagcctagtattgagcagggtgtaaataattttgtacagtacaagttcagccatttgcct
tccaaagaaagacagactatcatagagctggctaaaatgttcctgaatcgcatcaactac
tggcatttggaaactccctcccagcgaagactaaggtcaccaaatgatgatattgctgga
tataaggagaactatacaaggtggctgtgttattgtaatgtcccgcagttctgtgacagt
ttgaatcgatatgaaacaacacaggtatttgggagaaccctcctccgctctgtcttcact
gtgatgcggcgacagttactggaacaggcccggcaggagaaggataaacttccacaggag
aagcgaacattaatcctgacccatttccctaagttcttatctatgttggaggaagaggtt
tatagttccaattctccaatatgggatgaagattttatgtcggcatcatctcagactaat
ttagatcttggaatccaagcagttatcagcgcgcctcctgtcactatgtctgttgcatat
gctgcaagcccttcatccttggaacagtccagcagcgggagcctgagtccatctggaaaa
ccagcttgtgcccttgaaacaaacttaggtattaaaagaaaaagcagtgagccatttgct
gcagaagatgccaaaaagcccagagttgtaggagacatccccattgagctaatccatgaa
gtcatgtctacaataacagatcctactgccatgcttggaccagaaacaagcttcttgtcg
gcaatttctgcaagagatgaagcagccagactggaggaacgcaggggtgtaattgagttc
catgtggttgggaattctttaaatcagaagccgaacaaaaagatcatgatttggcttgtt
gggttacaaaatgttttctctcatcagctacctaggatgcccaaggaatatatcacacgg
ctggtctttgatccaaaacacaaaacccttgctctcatcaaagacgggcgtgtaattggt
gggatttgtttccgaatgtttccaacccagggctttactgaaattgtcttctgtgctgta
acgtcaaatgaacaagtgaagggctatggaacccatttaatgaatcatctcaaggagtac
cacattaagcataatgttctgaatttccttacttatgcagatgagtatgctatcggctac
ttcaaaaaacagggtttttctaaagatattaaagtgcctaaagccaggtatgttggatac
attaaggactatgaaggagctaccttaatggggtgtgaattgaatcccaaaattccatat
actgaattctctgtcattataaagaaacagaaagagattatcaaaaagattattgagcgg
aagcaagcacaaatacgaaaagtataccctggactatcctgctttaaggaaggagtacgg
cagattcccattgaaagcattcctgggattagagagactggttggaagcccagcataaag
gaaagaagtaaagagcccaaagatccagatcaactatacaacatattaaaaactatcctt
cagcaggtaaagagtcatcaaagtgcctggcctttcatggaacctgtaaagagaacagaa
gctcctggatattatgaagttatacgatttccaatggatctcaaaaccatgagtgaaaga
gtgaagaacaagtattatgtgacaaagaaactgttcatggcagatttgcagcgcatcttc
acaaactgcagagagtacaatccacccgaaagcgaatatttcaaatgtgcaaatattctg
gagaaattcttctattctaaaattaaggaagccgggctaatagacaaataa

DBGET integrated database retrieval system