KEGG   Xenopus tropicalis (western clawed frog): 100489063Help
Entry
100489063         CDS       T01011                                 

Definition
28S ribosomal protein S18b, mitochondrial-like
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Ribosome [BR:xtr03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100489063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 222 aa AA seqDB search
MATWLGGLGISTIKKALLCKAPVPTLPLCSRQLACLADSFDASSRYKDQPWEYMNSEEYL
QQYGQKSVWADYRRNHKGPIPPQKTRKTCVRGGKTCGNPCPICRDQKLGLNYRNVKLLQQ
FICPHTGTVYDPTKTGVCMKQQKALVKAITEATDHGLLPAHVPYIVLPHEDYLNIHGAVS
NTPSPKAGPWYTWYEWQEPNPKEVARLQKLYKPYLKEMMANK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctacttggttgggtggtctagggatatctacaatcaagaaggcgctattgtgtaag
gctcctgttcccactttgcccttgtgcagtcgccaacttgcatgtcttgcagactccttt
gatgcaagttctcgctataaagaccagccttgggaatatatgaatagtgaagaatattta
cagcagtatggtcaaaaatctgtatgggccgattacagacgaaaccataaagggcctatt
ccaccacaaaaaacccgtaaaacctgtgtcagaggaggaaagacttgtggaaatccgtgc
ccaatctgtcgggaccagaaacttggattgaattataggaatgtgaaattacttcaacag
tttatatgtccccatacaggaacagtgtatgatccaacaaagacaggtgtgtgtatgaaa
cagcagaaggccttggtgaaagctattacagaggcaacagatcatggacttcttcctgct
catgttccctatatagttctgcctcacgaagactacttaaatatacatggtgcagtttct
aacacaccttcacctaaagcaggaccttggtacacctggtatgagtggcaggagccaaac
cccaaagaagtagcaaggttgcagaagctttataaaccatacctgaaagagatgatggcc
aataaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system