KEGG   Xenopus tropicalis (western clawed frog): 100489063Help
Entry
100489063         CDS       T01011                                 

Gene name
mrps18b, mrp-s18-2, mrps18-2, ptd017, s18amt
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Ribosome [BR:xtr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    100489063 (mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
8
AA seq 222 aa AA seqDB search
MATWLGGLGISTIKKALLCKAPVPTLPLCSRQLACLADSFDASSRYKDQPWEYMNSEEYL
QQYGQKSVWADYRRNHKGPIPPQKTRKTCVRGGKTCGNPCPICRDQKLGLNYRNVKLLQQ
FICPHTGTVYDPTKTGVCMKQQKALVKAITEATDHGLLPAHVPYIVLPHEDYLNIHGAVS
NTPSPKAGPWYTWYEWQEPNPKEVARLQKLYKPYLKEMMANK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctacttggttgggtggtctagggatatctacaatcaagaaggcgctattgtgtaag
gctcctgttcccactttgcccttgtgcagtcgccaacttgcatgtcttgcagactccttt
gatgcaagttctcgctataaagaccagccttgggaatatatgaatagtgaagaatattta
cagcagtatggtcaaaaatctgtatgggccgattacagacgaaaccataaagggcctatt
ccaccacaaaaaacccgtaaaacctgtgtcagaggaggaaagacttgtggaaatccgtgc
ccaatctgtcgggaccagaaacttggattgaattataggaatgtgaaattacttcaacag
tttatatgtccccatacaggaacagtgtatgatccaacaaagacaggtgtgtgtatgaaa
cagcagaaggccttggtgaaagctattacagaggcaacagatcatggacttcttcctgct
catgttccctatatagttctgcctcacgaagactacttaaatatacatggtgcagtttct
aacacaccttcacctaaagcaggaccttggtacacctggtatgagtggcaggagccaaac
cccaaagaagtagcaaggttgcagaagctttataaaccatacctgaaagagatgatggcc
aataaatga

DBGET integrated database retrieval system