KEGG   Xenopus tropicalis (western clawed frog): 100489063Help
Entry
100489063         CDS       T01011                                 

Gene name
mrps18b
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Ribosome [BR:xtr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    100489063 (mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 222 aa AA seqDB search
MATWLGGLGISTIKKALLCKAPVPTLPLCSRQLACLADSFDASSRYKDQPWEYMNSEEYL
QQYGQKSVWADYRRNHKGPIPPQKTRKTCVRGGKTCGNPCPICRDQKLGLNYRNVKLLQQ
FICPHTGTVYDPTKTGVCMKQQKALVKAITEATDHGLLPAHVPYIVLPHEDYLNIHGAVS
NTPSPKAGPWYTWYEWQEPNPKEVARLQKLYKPYLKEMMANK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctacttggttgggtggtctagggatatctacaatcaagaaggcgctattgtgtaag
gctcctgttcccactttgcccttgtgcagtcgccaacttgcatgtcttgcagactccttt
gatgcaagttctcgctataaagaccagccttgggaatatatgaatagtgaagaatattta
cagcagtatggtcaaaaatctgtatgggccgattacagacgaaaccataaagggcctatt
ccaccacaaaaaacccgtaaaacctgtgtcagaggaggaaagacttgtggaaatccgtgc
ccaatctgtcgggaccagaaacttggattgaattataggaatgtgaaattacttcaacag
tttatatgtccccatacaggaacagtgtatgatccaacaaagacaggtgtgtgtatgaaa
cagcagaaggccttggtgaaagctattacagaggcaacagatcatggacttcttcctgct
catgttccctatatagttctgcctcacgaagactacttaaatatacatggtgcagtttct
aacacaccttcacctaaagcaggaccttggtacacctggtatgagtggcaggagccaaac
cccaaagaagtagcaaggttgcagaagctttataaaccatacctgaaagagatgatggcc
aataaatga

DBGET integrated database retrieval system