KEGG   Xenopus tropicalis (western clawed frog): 100489292Help
Entry
100489292         CDS       T01011                                 

Gene name
gemin7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100489292 (gemin7)
Spliceosome [BR:xtr03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100489292 (gemin7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 135 aa AA seqDB search
MKGAVREEPDGCSMKEKRDPPLLPQVPILRLPRPPSPSGRGFDLSSPRALAHCPPKDHQK
CRSFLRQLFLRSLLASAGLPVTFSLYQRVTVSADRFNACDMEGQNFQVSDLQTPIGVQKE
ALIRGPDIISYSFHV
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtgctgtaagggaagagccagatggttgcagcatgaaggagaaaagagaccca
cctcttctcccacaggtacccatactgcgcctccctcgtcctccttcaccatctggccgt
ggatttgacctttcttcaccccgagcacttgctcactgcccgcccaaagatcaccagaag
tgtcgctcttttcttcgccagctattcctccgcagccttcttgcatcagctggccttcca
gtcaccttctcattgtatcagcgtgtaaccgtgagtgctgatcgcttcaatgcctgtgat
atggaaggacaaaattttcaggtctctgacctacagactcctattggtgtgcaaaaggaa
gcacttatccggggccccgacattatttcatactcttttcatgtctga

DBGET integrated database retrieval system