KEGG   Xenopus tropicalis (western clawed frog): 100489366Help
Entry
100489366         CDS       T01011                                 

Gene name
b3galt4
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100489366 (b3galt4)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100489366 (b3galt4)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     100489366 (b3galt4)
Glycosyltransferases [BR:xtr01003]
 Glycan extension
  Glycolipid
   100489366 (b3galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 346 aa AA seqDB search
MLSHFAFNIHRLCIPRRTFSRFLCLSLFICILIVFSEHYEEIISCALPLFYPTRSPPSTT
PFKPPAILLSPPKACSPAPMLLILVSSAPFHHERRNAIRQTWGSSSNLDSQAVTFFVLGV
PQSHNDQAALLEEAKIHGDIIQAAFNDSYRNLTMKTLVGLSWMSQRCHGARFLLKTDDDV
FVNTFSLSRYLQGQHGPLYLGRVHWKVYPNRDPDSRHYTSTDIYPEKYFSPYCSGTGYIL
SHEVVEWLLQQTGKSPIIPLEDVYVGLLAWAAGISPKHSASMSGSMKIPHNGCCYSTMFS
SHGLTPKGMKEAWEILSEARNYWCPFALLRCKILGNLIEEGGFGQI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctttcacactttgcttttaatatacatcgcctgtgtatcccgcgtcggactttttct
cgttttttatgcctttctctttttatttgtattcttattgtcttctcagagcactatgaa
gagattatttcctgcgcacttccacttttctatccaactcgctctccgccttcaactact
ccatttaaacccccagctattctcctttcccctcctaaagcttgttcaccagcccccatg
cttcttatcttagtctctagtgctccctttcaccatgaacggcgcaatgccatcaggcag
acttgggggtcttcatccaacttggattctcaggcagtcactttttttgtactaggggtt
cctcagtcacacaatgatcaagctgcattgttggaggaggcaaagatccatggggatatc
atccaagctgcctttaatgacagttaccgcaacttgactatgaaaactttggtgggacta
tcatggatgtctcagagatgtcatggtgctaggttcctgctgaaaactgacgatgatgta
tttgtaaatacattttccttgtcaagataccttcagggacaacatggacctctctattta
ggaagggtgcattggaaagtctaccctaaccgtgatcctgacagtcggcattacacttct
actgatatctacccagaaaagtactttagtccttactgcagtggtacaggttatattttg
tcccatgaagtagttgagtggctgttgcagcagactggcaaaagccctattattccattg
gaggacgtctatgtgggactgttggcatgggcagctgggatatcccccaaacattcagca
agtatgtcaggctccatgaaaataccacacaatggctgctgttacagcacaatgttcagc
tcccatggcctaacacccaagggcatgaaggaggcttgggaaattttgagtgaagcaaga
aattactggtgcccatttgcactgctgcgctgtaagatactgggcaatttgatagaagag
ggaggatttggacagatatga

DBGET integrated database retrieval system