KEGG   Xenopus tropicalis (western clawed frog): 100489505Help
Entry
100489505         CDS       T01011                                 

Definition
UDP-glucuronosyltransferase 1-1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100489505
   00053 Ascorbate and aldarate metabolism
    100489505
   00500 Starch and sucrose metabolism
    100489505
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100489505
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100489505
   00860 Porphyrin and chlorophyll metabolism
    100489505
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100489505
   00982 Drug metabolism - cytochrome P450
    100489505
   00983 Drug metabolism - other enzymes
    100489505
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100489505
Glycosyltransferases [BR:xtr01003]
 Others
  Hydrophobic molecule
   100489505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 521 aa AA seqDB search
MPPLFLLLVGFGVVCLLELPGLSEGGKVLVIPQDTNVWLDMHSMVNKLKKNGHEIVVVIP
KNNDISHLSEDFIVKTYTVPALDSGFQIYLEPTEPLFQMSSFLEAISTEYRRWKYTTSVL
CNTCQHLLDDLELIRYLERSLFDAAIMDPWFPCGPVLAEHLSLKSIYVMPGFSCGWEYTA
TQCPKSPYQHYGQMDFTQRMKSLLAESLEYIACQEIKAEYTRLASQFLHKHINILQVFSQ
AELWLFRYDFVVESAKPVMPNMIYIGGDTCKEKEKLPHEFEKLVNSSGEHGFVVFSLGSM
VSEIPMNKAMDIAEALKSIPQKVFWRYTGKAPPNLGENTHLVKWLPQNDLLAHPKARAFI
THAGSHGIYEGICNAVPMVMMPLFGDQMDNAKRIESRGAGLTLNVLHMTPEDLSNAVRAV
INNPVYKENIQRMSSLHLDRPIHPLDLAVHWVEFVMRHKGAPHLRPAAHDLNWFQYYSLD
VIGFLLAVLLTALFISLKCCTFVFRRCFKRNSKKQRKSKSQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctttattcctgttacttgttggatttggggtcgtttgcttgctggaactccct
ggactgtccgagggtgggaaagtgctagttatcccacaggacaccaatgtctggctggac
atgcactcaatggtaaataaactaaagaagaacgggcacgagattgttgtggtgataccc
aagaataatgacatttcccatttgtctgaagactttattgtgaagacatatacggtccct
gcccttgattccggcttccagatttatttagaacccacagaaccactgttccagatgagt
agttttctggaagctattagcacagagtacagaaggtggaaatatacaacatctgttctt
tgtaacacctgtcagcatctactagatgacctagaactaatcagatacttggagagaagc
ttgtttgatgccgccatcatggatccttggttcccctgtggcccggttcttgcagagcac
ctgtcccttaaatccatttatgtaatgccaggattctcatgtggatgggagtacacagcc
actcagtgcccaaaatctccctaccagcattatggtcagatggactttacccagcgaatg
aaaagccttctagctgagtcattggaatacattgcttgccaggaaataaaggcagagtac
acaaggctggcttcccaatttctgcacaagcacataaacattctacaggtttttagtcag
gccgaattatggctcttcagatatgattttgtggtggaatctgctaagcctgtgatgcca
aatatgatttatataggaggagatacttgcaaggagaaggagaaattaccccatgagttt
gagaagctggttaacagctctggggaacatggatttgtggtgttttccttgggatccatg
gtgtctgaaattcccatgaataaagccatggatatagcagaagctctgaaatccattcct
cagaaggttttctggaggtacacagggaaagcacctccaaatctgggagagaatacccat
ctagtgaagtggctgccacagaatgatctgcttgcccatcccaaagctcgtgccttcatc
actcacgctggatcacatggcatttatgagggaatctgtaatgcggtccccatggtcatg
atgccattgtttggggaccagatggataatgcaaagcgtattgagtctcggggagcagga
ttgactctcaatgtgctgcacatgacccctgaggacctcagcaatgcagtgagggctgtt
ataaacaatccagtctacaaggagaacattcagcgcatgtcttctctgcacctggacaga
ccaatccatcccctggaccttgctgtgcactgggtggagtttgttatgagacacaaaggt
gccccccacctgcgcccggccgctcatgatttaaattggtttcagtattactctctggat
gttattggcttcctactggctgtactgctcaccgcactgttcatcagccttaagtgctgc
acttttgtctttcgacgttgcttcaaaaggaattccaagaaacaacgtaaatccaagtct
cagtag

DBGET integrated database retrieval system