KEGG   Xenopus tropicalis (western clawed frog): 100489813Help
Entry
100489813         CDS       T01011                                 

Gene name
cyp21a2.1, ca21h, cah1, cps1, cyp21, cyp21b, p450c21b
Definition
(RefSeq) cytochrome P450 family 21 subfamily A member 2
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100489813 (cyp21a2.1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100489813 (cyp21a2.1)
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP21 family
   100489813 (cyp21a2.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 516 aa AA seqDB search
MPLSLSMALLLLLLLFLVLLSLQWAKKYFLGFSNPHVHYPPCPPPLPFLGNLLHLAHKDL
PIHLLHLSRKYGSIYRLSFWGKDFVVLNNSNLIREALLKKWADFAGRPKSYIGDLISLGG
KDLSLGDYTPVWKVQRRLTHTSLQNCVRNDLENVLIREARLLCQDCLNLNGEPVDISRSF
SLRTCRIIAELTFGTTYDLSDPKFQEIHKCIVNIIKLWESPSVTALDFIPFLQKFPNQTL
KLLMDTAKQRDSFIKSQVEAHKAHLPSSKCDEDILDGMMRFLLEKSGDDSSGMSEFSEDH
LHMAVVDLFIGGTETTASLLTWTVAYLMHYPEAQDKIHQEIIGAVGMERYATYTDRNSLP
YLNATVSEMLRLRPVVPLAVPHCTIRDTSIAGYTIPKGTTVIPNIYAAHLDETIWDNPTQ
FYPERFLSPSENSHSSRALLPFSVGARLCIGETLARMEVFFFLSHLLRDFRLLPPSPELL
PELSGVFGINFKCRPFLVCISPRENTPKIQDLNNKT
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagtctcagcatggctcttcttctgctcctacttctcttcctcgtgctcctc
tccctgcagtgggcaaagaagtatttcctgggattctctaaccctcatgtacattaccca
ccttgcccgccccccttaccatttctaggcaacctgcttcacctggcgcacaaagatctg
ccaattcacttgctgcatctctctagaaaatatgggtctatttatcgtctaagcttttgg
gggaaagattttgtcgtgttaaataattctaacttgatccgtgaagctctgcttaagaag
tgggcagattttgctggaagacccaagagttacataggtgatctgatatccctgggcggg
aaggatctgtctcttggagactacacgccagtgtggaaggtgcagaggcgtctcacccac
acatccctgcagaactgcgtgcgcaatgacctagagaatgtgctgatcagagaggccaga
ttattatgccaggattgcctgaacctgaatggggagccagtggatatatctcgatcattc
tctctgcgaacctgcaggatcatagcagaactgacatttggtaccacgtatgatctttca
gaccccaaattccaggagattcacaaatgtattgttaatattattaagttatgggagtca
ccaagtgttactgctctggatttcataccatttctgcagaagttccccaatcagacttta
aagcttctgatggacactgcaaagcaaagagattcctttataaagagccaagtggaagct
cacaaggcacatctcccatccagtaaatgtgatgaagacattttagatggaatgatgcga
tttcttctagaaaaatctggagatgacagcagcggaatgtcagaattttctgaggatcat
cttcatatggccgttgttgacctctttataggagggacagaaaccactgcatccttatta
acatggacagtggcctacctcatgcattacccagaagcacaagataaaattcatcaggag
atcataggagcagtgggaatggagagatatgcgacatatacagaccgtaacagcttgccc
taccttaatgccactgtttctgagatgctcagacttcgacctgtggttcccctggctgtg
ccacactgtaccattagggatacaagcattgcaggatataccatccctaagggcaccact
gtaatccccaatatttatgctgctcaccttgatgagacaatatgggacaatcctacccag
ttctatcctgaacgcttcctctccccatcagaaaactcacattcttcccgcgctctcctt
ccattcagtgtgggtgcaaggctttgtattggtgagactttggctcgtatggaggtgttt
ttctttttgtctcacctcctgagggatttccgcctcttgcccccttctcctgaacttttg
cctgaactcagtggggtgtttggaatcaacttcaagtgccgcccatttctggtctgtata
tcaccccgagaaaacacaccaaaaatacaggatttaaataataaaacatga

DBGET integrated database retrieval system