KEGG   Xenopus tropicalis (western clawed frog): 100489960Help
Entry
100489960         CDS       T01011                                 

Gene name
sos1
Definition
son of sevenless homolog 1 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100489960 (sos1)
   04012 ErbB signaling pathway
    100489960 (sos1)
   04630 Jak-STAT signaling pathway
    100489960 (sos1)
   04068 FoxO signaling pathway
    100489960 (sos1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100489960 (sos1)
  Cell communication
   04510 Focal adhesion
    100489960 (sos1)
   04540 Gap junction
    100489960 (sos1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100489960 (sos1)
   04912 GnRH signaling pathway
    100489960 (sos1)
  Development
   04320 Dorso-ventral axis formation
    100489960 (sos1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1325 aa AA seqDB search
MPREAVMQAPQFQYDFFSEENSPKWKGLLVGALKKVQEQVHPNLSSAEDALQYVEELILQ
LLSMLCQAQPRSVLDVEERVQKSFPHPIDKWAIADAQSAIEKKKRRNPLSLPVDKIHPLL
KEVLGYKIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEITKQDIKVAMCVDKVLMD
MFHQDEEDMSVLCLADEEPSTLGEQTYYDLVKSFMAEVRQYIRELNLIIKVFREPFVSSP
KLFSSHDVENIFSRIIDIHELSVKLLGLIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDP
YESYAQDILRPGFHDHFLGQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYYCLHYF
EFIKQLEEKSEDEEDKECLKQSITALLNLQSSMERICSKSLAKRRLSESACRFYSQQMKG
KQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGALTRVGAKHERHIFLFDGLMICCKSN
HGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYRHAFEIILKDENSVIFAAKSAEEK
NNWMAALISLQYRSTLERMLDVTMSQEEKEEQMRLPSPKLYRFTEPDSEENIVFEENVQP
KSGIPIIKAGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPDPE
PSEADRIAMENGDQPLSAELKRFRKEYVQPVQLRVLNVCRHWVEHHFYDFERDSDLLIRL
EEFIGTVRGKAMKKWVESITKIINRKKQVQANGPSHSITFESLPPAVEWHISRSGQIETF
DLLTLHPIEIARQLTLLESDLYRAVQSSELVGSVWTKEDKETNSPNLLKMIRHTTNLTLW
FEKCIVETENLEERVVVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPIYRLDNTFEQVP
SRQRKILEEAHELSEDHQKKYLAKLRSINPPCVPFCGIYLTNILKTEEGNPDFLKRHGKE
LVNFSKRRKVAEITGEIQQYQNQPYCLDVEPDIRKFFENLNPMGNTPEKEFEDYLFKKSL
DIEPRNAKTLPRFAKKYNYNLKSPGVRPSNPRPGTMKHPTPLQQEPRKISYSRIPESETE
NLASAPNSPRTPLTPPPPSAASSTTDVCSVFDSDPSSPFHSRSASVSSISFTKNLDEMQV
PPPVPPRRRPESAPAESSPSKIISKHLDSPPAIPPRQPTSKVYSPRYQMSERSSVSDAPE
SPPLLPPREPVRTPDVFSISPLHLQPPPLGRKSEHTNTFFPYSPSPFTPPPPQTPSPHGT
RRHLPSPPLIPQDVELASSTGPPVPPRQSTSQPIPKLPPKTYKREPPHPSIHRDGPPLLE
NANSL
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggaagccgtcatgcaggccccacagtttcagtacgacttcttcagtgaggag
aactcccccaaatggaagggtctgctggttggtgccctgaaaaaggttcaagagcaagtc
catcccaacctttcatctgctgaagatgcgctccagtatgttgaagagttaatcctgcag
ctgctaagcatgctttgccaagcgcagccccgcagtgtcctggatgttgaggaacgtgtg
cagaagagttttcctcaccccattgacaaatgggcgattgctgatgctcagtctgctatt
gaaaagaagaaacgtagaaatccattgtctcttcctgtagataaaatccatccattatta
aaggaagtcttaggttataaaattgatcatcaggtatctgtttacatagttgcagtatta
gaatacatttctgcagatattttaaaacttgctgggaattacgttcggaatataaggcat
tatgaaattacaaagcaagacataaaagttgcaatgtgtgttgataaggtattaatggat
atgtttcatcaagatgaagaagacatgagtgtactgtgcttagctgatgaagagccatct
actttaggtgaacaaacctactatgaccttgtcaagtcttttatggcagaggttagacag
tacataagagaactgaacctcatcatcaaagtgttccgggaaccatttgtatccagcccc
aaattattctctagtcatgatgtagaaaatatatttagtcgaataattgatatccatgaa
cttagtgtgaaactgttgggccttattgaggacactgtggaaatgacagatgaaggcagc
cctcatcctttagtaggaagctgctttgaggatctggctgaggagctggcttttgaccct
tatgagtcctatgctcaggatattctacgaccaggttttcatgatcatttccttggccag
ctttcgaagcctggtgctgccctctatctacagtctataggtgaaggttttaaggaagct
gtgcaatatgttttacctcggctacttcttgctcctgtttactactgcctgcactacttt
gaatttattaagcaattagaagaaaagagtgaggatgaggaagataaagaatgtttaaag
cagtcaataactgctctactaaaccttcagagcagcatggaaagaatatgttccaagagc
cttgctaagaggcgactcagtgaatctgcatgtcgattttatagtcagcaaatgaagggg
aaacaactagctattaagaaaatgaatgaaattcaaaagaacattgatggatgggaggga
aaagacattgggcagtgctgtaacgaattcatcatggagggagccttaacacgtgttggg
gctaaacacgaaagacacatattcctatttgatggtttgatgatctgttgcaagtcaaat
catggacagccaagactgccaggtgctagtaatgcagagtatcgattgaaagagaagttc
tttatgcgaaaggtacaaatcaacgacaaggatgacactaacgagtacagacatgctttt
gagattatcttaaaagacgagaacagtgttatttttgctgcaaagtcagcagaggaaaaa
aataactggatggctgccttaatatccctgcagtaccgaagtactttagaaagaatgttg
gatgtaactatgtcacaagaagagaaagaggaacaaatgaggctccctagtcctaagctt
tacaggtttactgaacccgattctgaggagaatattgtatttgaggaaaatgtgcagccc
aaatctgggatacccatcatcaaagctgggactgtagtaaaactcattgaacgactaact
tatcacatgtatgcagatcccaactttgttcgaacatttctgacaacatatagatctttt
tgcaaaccccaagaacttttaagccttcttatagaaaggtttgagattccagatcctgaa
ccaagtgaagctgaccggatagctatggagaatggtgatcagccacttagcgcagagctg
aaaagatttagaaaggaatatgtacagcctgtacagctgcgtgttctaaatgtttgtcga
cattgggtagaacatcatttttatgactttgaacgagattcagatcttttaatccgacta
gaagaattcattggaacagttagaggcaaagcaatgaaaaaatgggtagaatcaataact
aaaataattaatcgaaagaagcaggtgcaagctaatggaccgagccacagtataaccttt
gaaagtttaccacctgccgtagaatggcacattagcaggagtggtcaaatagaaaccttt
gacttgcttactttgcatccaatagagattgctcggcagttgactttgttggagtcagac
ctttacagggctgtgcagtcatcagagcttgttggaagtgtatggactaaggaagacaaa
gaaaccaactcccccaatctccttaagatgatcagacacacaactaatctcaccctctgg
tttgaaaagtgcattgtagaaactgaaaatctggaagagcgagtggttgtggttagtcgc
atcatagaaattctccaagtgtttcaagagcttaataattttaatggtgtacttgaagtt
gtgagtgccatgaactcttctcctatatacaggctggataacacctttgagcaagtacca
agccgtcagagaaaaatattggaagaagctcatgaactgagtgaagatcaccaaaagaaa
tatttggcgaaactcaggtcaattaatccaccgtgtgtgcctttttgtggaatctatttg
acaaatattttaaagacagaagaaggcaaccccgattttcttaagaggcatgggaaagaa
cttgtgaattttagcaaaaggaggaaagtggctgaaatcactggggaaatacagcagtac
cagaatcagccttattgcttagacgtagaaccagatatacgaaaattttttgagaattta
aatccaatgggaaataccccagagaaagaatttgaggattacttgtttaagaagtccttg
gatattgagccacgcaatgcaaagactctgccaagatttgctaaaaagtataattataat
cttaaatctcctggggtacgcccatccaatccaaggccaggtacaatgaagcaccctact
cctctgcaacaagaacccaggaaaatcagctacagtcgcataccagagagtgaaacagaa
aatttagcatctgctccaaactctcctcggactcctttaacaccacctcctccatctgct
gcctctagtaccactgacgtgtgcagtgtgtttgattcagatccttcaagtccatttcat
tcacgctcagcttcagtatcatcaataagttttactaagaacctggatgaaatgcaggtt
cctcctcctgtaccaccaaggcgaagacctgaatctgctcccgcagaatcatctccatca
aagataatatcaaagcatttggacagccctccagcaatccctccccgtcagcctacatca
aaagtatactccccacggtaccaaatgtctgaacgttcatcagtttctgatgcaccagag
agccctccacttttaccaccacgagaaccagtacgtacaccagatgtcttctccatttct
ccactacatctccagcctcccccacttggtcggaaaagtgaacataccaacaccttcttt
ccatacagcccttcgccttttaccccacctccaccacagactccatcccctcatgggaca
agaagacacctgccctccccacccttaataccgcaagatgtagaactagcgtcttctact
ggaccacctgtcccacctcgacaaagcacttctcaacctatcccaaagctccctccaaaa
acttacaaaagagagccccctcatccttctattcacagagatggtcctccactattggaa
aatgcaaactccttgtaa

DBGET integrated database retrieval system