KEGG   Xenopus tropicalis (western clawed frog): 100489962Help
Entry
100489962         CDS       T01011                                 

Definition
serine/threonine-protein kinase mos-like
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xtr04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xtr04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xtr04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 355 aa AA seqDB search
MPSPIPVERFLPRDLSPSIDLRPCSSPLELSHRKVPGSGRHRLLPPRLAWCSIDWEQVRL
LEPVGSGGFGSVYRAIYKGETVALKKVKRCTKNSLASRQSFWAELNAARLRHPHVVRVLA
ASASCPGDPGCPGTIIMEYAGTDTLHGRIYGRCPPLGAAVCMRYARHVADGLCFLHRDGV
VHLDLKPANVLLAPGGLCKIGDFGCSQRLRDGDSAGGEPCCTQLRHVGGTYTHRAPELLK
GEPVTAKADIYSFAITLWQMVSRELPYTGDRQCVLYAVVAYALRPEMGPLFSCTEEGRAV
RHIVQSCWAARPEERPSAEQLLERLEQESALYRGVSSSPSAQYTCPPLSAAHRGP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccctatccctgtggagcgcttcctgccccgggacctgtccccatccatagac
ctgaggccatgcagcagcccgctggaactgagccaccgcaaagtgccgggcagcggccgc
caccgcctcctccctccccgcctggcctggtgcagtattgactgggagcaggtgcggctg
ctggagccggtgggttccggggggttcggctccgtgtaccgggccatatacaaaggggag
accgtggcgctgaagaaggtgaagcgttgcaccaagaacagcctggcctcccggcagagc
ttctgggccgaactgaacgcagcccggctccgccatccgcatgtggtgcgcgtcctggcc
gccagcgcctcttgccccggggaccccggctgccccggtaccattatcatggaatacgcc
gggaccgacaccctgcatggccgtatctatgggcgctgcccgccgctgggggctgccgtg
tgtatgcgctatgcccgacacgtcgccgacggactgtgctttctgcaccgggatggggtg
gtgcatctggatctgaaaccggccaatgtcctgcttgccccggggggcctgtgtaagatc
ggggatttcggctgctctcagaggctccgggatggggattctgctgggggggagccgtgt
tgcacccaactccgccatgtcggggggacctacacccaccgagccccggagctgctcaag
ggagaacccgtcactgccaaagccgatatctactcgttcgccattaccctgtggcagatg
gtgagccgggagttgccctacaccggggaccgccagtgcgttctctatgcggtagtggcc
tatgctctgcggccggagatgggcccgttattcagctgcacggaggagggcagagcggtc
cggcacattgtgcagagctgttgggcagcccgacctgaggagagaccgagtgccgagcaa
ctgctggagagactggagcaggaatctgccctgtacagaggggtctcttcctcccctagc
gctcagtatacctgccctcctcttagcgctgcccatagaggcccatag

DBGET integrated database retrieval system