KEGG   Xenopus tropicalis (western clawed frog): 100489962Help
Entry
100489962         CDS       T01011                                 

Definition
serine/threonine-protein kinase mos-like
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100489962
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100489962
  Cell growth and death
   04114 Oocyte meiosis
    100489962
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100489962
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100489962
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100489962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 355 aa AA seqDB search
MPSPIPVERFLPRDLSPSIDLRPCSSPLELSHRKVPGSGRHRLLPPRLAWCSIDWEQVRL
LEPVGSGGFGSVYRAIYKGETVALKKVKRCTKNSLASRQSFWAELNAARLRHPHVVRVLA
ASASCPGDPGCPGTIIMEYAGTDTLHGRIYGRCPPLGAAVCMRYARHVADGLCFLHRDGV
VHLDLKPANVLLAPGGLCKIGDFGCSQRLRDGDSAGGEPCCTQLRHVGGTYTHRAPELLK
GEPVTAKADIYSFAITLWQMVSRELPYTGDRQCVLYAVVAYALRPEMGPLFSCTEEGRAV
RHIVQSCWAARPEERPSAEQLLERLEQESALYRGVSSSPSAQYTCPPLSAAHRGP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccctatccctgtggagcgcttcctgccccgggacctgtccccatccatagac
ctgaggccatgcagcagcccgctggaactgagccaccgcaaagtgccgggcagcggccgc
caccgcctcctccctccccgcctggcctggtgcagtattgactgggagcaggtgcggctg
ctggagccggtgggttccggggggttcggctccgtgtaccgggccatatacaaaggggag
accgtggcgctgaagaaggtgaagcgttgcaccaagaacagcctggcctcccggcagagc
ttctgggccgaactgaacgcagcccggctccgccatccgcatgtggtgcgcgtcctggcc
gccagcgcctcttgccccggggaccccggctgccccggtaccattatcatggaatacgcc
gggaccgacaccctgcatggccgtatctatgggcgctgcccgccgctgggggctgccgtg
tgtatgcgctatgcccgacacgtcgccgacggactgtgctttctgcaccgggatggggtg
gtgcatctggatctgaaaccggccaatgtcctgcttgccccggggggcctgtgtaagatc
ggggatttcggctgctctcagaggctccgggatggggattctgctgggggggagccgtgt
tgcacccaactccgccatgtcggggggacctacacccaccgagccccggagctgctcaag
ggagaacccgtcactgccaaagccgatatctactcgttcgccattaccctgtggcagatg
gtgagccgggagttgccctacaccggggaccgccagtgcgttctctatgcggtagtggcc
tatgctctgcggccggagatgggcccgttattcagctgcacggaggagggcagagcggtc
cggcacattgtgcagagctgttgggcagcccgacctgaggagagaccgagtgccgagcaa
ctgctggagagactggagcaggaatctgccctgtacagaggggtctcttcctcccctagc
gctcagtatacctgccctcctcttagcgctgcccatagaggcccatag

DBGET integrated database retrieval system