KEGG   Xenopus tropicalis (western clawed frog): 100490033Help
Entry
100490033         CDS       T01011                                 

Gene name
usp34
Definition
ubiquitin specific peptidase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100490033 (usp34)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100490033 (usp34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 3550 aa AA seqDB search
MCEICADLVEVLNEISDSEGNDGLQLRKEHALKIFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIGQVQALRDQLLKICTTSPDSNWQDDHNPSEELLNVEKEPQDEEGEESHK
QPCNPQEKTLDNTRTCNLTEEESIKSTDLFNLWSTDEKEKLLLCVAKIFQIQFPLYTAYK
HNTHPTIEDISAQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPET
LPFQIAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLM
WSTVKEPLDTALCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSD
TETSIAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAA
QLKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSGLHPSAHTEQTLYLASMLIKALWNNAL
AAKAQLSKQSSFASLLNTNLPMGNKKGSPATSPQSSDNSDTHHSGGSDIEMDEQILNRSK
HVQQRLSDTEESMQGSSDETANSGEDASSGPGSSSGHSDGSSNEVNSSHASQSAGSPGSE
VHSEDIVDMEAMKEDDEEDEHSINTAKNRVSELQKRKLESQAGICLGESQGPVERSTTSN
GSGKDLVFNSESVQPGDSRIRILDSCSHPEESEHDMAGEMSTSHIQGSIDTCIARSGDFL
GEAIGNELFNCRRFIGPQHHHHHHHHHHHHHHHHHHHHHHHHEGHMVDDMLSADDVSCSS
SQVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPSVH
KHQYNSNAMVDINLDNVCKKGNTLLWDLVQDDDAIHLSEGLINEAEKLLCSLVCWFTDRQ
IRMRFIEGCLENLANNRSVVVSLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFF
DNLVHYIQSIRDGQHKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCL
VEDTECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCN
LARLATSAYDGGSNSELCGMDQFWGIALRAHTGDVSRAAIQYINSYYINGKTGLEKEHEF
ISKCMESLMIASSNLEQDSQSSLTIIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISS
HLKALNDKQSLPLRIVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKDQMNQQAQ
LQEFGQSSRKGDFPGGLMGPVRMISSGHELTTDYDEKTLHELGFKDMQMVFVSLGAPRRE
RKGEGVQLPASCLPPPQKENIPMLLLLQEPHLSTLFGLLEMLASFKPPSGEMVMEDVEHA
RCEELHLHAENLSRRVWELLMLLPTCPNMLQAFQNVSDEQGSDGPCWKDLLRIKSAHKLL
YALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQIENSKNTWSCKFVAAGGLQQLI
EIFNSGILEPKEQESWTVWQLDCLACLLKLICQFAVDPTDLDLAYHDVFAWSGVAESHRK
RAWPGKSRKSAGEHPKGLHIPRLTEVFLVLVQGTCLIQRLMSVAYTYDNIAPRVLKAQSD
HRSRHEVTHYSMWLLVSWAHCCSVVKSSLADSDNLQDWLKKLTLLIPETAVRHEACNGLY
KLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPVRMEDYEEEMILRPGCKEYFWLL
CKLIDNIHVKDASQTTLLDLDALARHLADCIRSREIFDYQDGNVEDDGMTGLLRLATSVI
KHKPPFKFSREGQEFLRDVFNLLFLLPSLKDKLQPKCKSHSSRAAAYDLLVEMVKGSVEN
YRLLHNWVMAQHMQSSHAPYKWDYWPHDDVRAECRFVGLTNLGATCYLASTIQQLYMIPE
ARQAIFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQK
DMTEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVAD
MKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVT
MMKEKVNTHFSFPLRLDMTPYTEDFLMGKNDRIEGFKEDCEEPKQTESYEYDLIGVTVHT
GTADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVT
DKFMDFSFEKTHSAYMLFYKRVEPEEETGREFKFDVSSELLEWIWHDNMQFLQDKNIFEH
TYFGFMWQLCSSIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFN
NSQAACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGM
EDGSDDMDGPVEDIGSRSCVTRFVKTLLSIMEHGVKPHSKHLTEYFAFLYEFVKMGEEES
QFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEEEGEEEEEEDILSLAEEKYRPAALEKM
IALIAFLVEQSRSERHLTLSQNDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYN
NRLAEHIASMLFTSIAKLTPEAANPFFKLLTMIMEFAGGPPGMPPFASYILQRIWEVIEY
NPSQCLDWLAVQTPRNKLAHNWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSF
RQMFRSTRSLHIPTRDLPLSPDTTVVLHQVYNALLGLLSRAKLYVDAAAHGTTKLVPYFS
FMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCVDCPENVR
LIVQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRMCCEQSPAFTRQLASHQN
IQWAFKNLTPHASQYPAAVEELFNLMQLFVAQRPDMREEELEDIKQFKKTTISCYLRCLD
GRSCWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVEL
LSIFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKEL
VLLSPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENMKLIGAKSNIRPPRPELNM
CLLPTMVESNKGKDDVYDRMLLDYLSSYHQFIHLLCRVAINCEKFTETLIKLSVLIAYEG
LSLHLALFPKLWTELCQTQSAMAKSCTKLLCEDPVFAEYIKCILMDERLFLNNSIVYTFL
THFLGKVQSQVFSETNCANLMNTIITNLINQYQNVESDFGNRVDISKASSTLNGDLRALA
LLLSVHTPKQLNTALIPTLQELLSKCRACQQQRNSLQEQEAKEGKTKDDEGATPVKRRRV
SSDEEHMVDSCISDLKNDREVSTPTSTSDNETRDSSIIDPGTEQDPPSPENSSSKEFRIE
VSSSFSEDLMLSSRPQQVEDQTGSSSKFEDSKEMKDLQSPKDATVTDEDNELPSTSISAV
LADLADLRSCDAQTLSSNDPDLSLSLNCDHSRGLFSHVQQNDILDTLCRTIESTILVVSR
ISGKENKAAS
NT seq 10653 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaaatctgtgcagatctggtggaggtgttgaatgagatctcggactctgaaggc
aatgatggattacagctcagaaaagaacatgctctcaagatatttgcatacatcaattct
tggacgcagaggcagtgtctgtgctgttttaaggagtataagcatttggaaatctttaac
caagttgtgtgcgccctaattaatttggtaattggccaagtccaagcccttcgggaccag
cttttaaaaatttgcactactagccctgattctaactggcaggatgaccataacccatct
gaggagctgctaaatgtagaaaaggagccccaagatgaggagggggaggaaagtcacaag
cagccatgcaatccccaggaaaagacgctagataacacaagaacttgtaacctgactgaa
gaagaatcaataaaaagcactgacctgtttaacttatggagtactgacgaaaaagaaaaa
ctgttgttgtgtgtggcaaaaatctttcaaattcagtttcctctctatactgcttacaag
cataacacacaccccaccatagaggatatctctgctcaagaaagcaatatcttaggggcc
ttctgtgatatgaatgatgtagaagtacctttgcaccttctccgttatgtttgtctgttt
tgtggaaagaatggactttctctcatgaaggattgttttgaatatggcactcccgagact
cttccctttcaaattgcgcatgcattcatcactgttgtatcaaatatcagaatatggctg
cacatccctgctgttatgcaacacatcatcccatttaggacctatgtcataaggtattta
tgtaaattgtcagaccaggagctgcggcagagtgcagcgcgtaacatggctgatcttatg
tggagtacagtaaaagagcctttggacacagctttgtgctttgataaggagagccttgat
ttggctttcaaatattttatgtcacctaccttaacaatgagacttgccggactaagtcag
attacgaaccaactgcacacatttaatgatgtctgcaataacgaatctttggtttctgac
actgaaacatctatagcaaaagagcttgcagactggcttatcagcaataatgtagtggaa
catatttttggaccaaatttacatatagagattataaagcagtgccaagttattctaaac
tttttggctgcagaaggtcggctaagcactcaacacattgactgtatttgggcagcagca
cagttaaaacattgcagccgatacatacatgacctgtttccttcattgatcaaaaacttg
gatccagtgcctctgagacatctgctcaacctggtatcgggtcttcatcctagcgcgcac
actgagcagaccttatacttggcatcaatgctgatcaaagctctctggaataatgcacta
gccgctaaagctcagctttctaagcagagctcatttgcatcattgctgaatactaattta
ccaatggggaataagaaaggttctccagcaaccagccctcagagcagtgacaacagtgac
actcatcacagtggaggaagtgacattgaaatggacgaacaaatcctaaatagatctaaa
catgtacagcagcggctgtctgacacagaggaatctatgcaagggagttcagatgaaact
gctaacagtggagaagatgcaagtagtggacctggaagtagcagtgggcacagtgatggg
tcaagcaatgaagtgaattccagccatgcaagtcagtctgctggaagcccaggcagtgag
gtgcactctgaggatatagttgatatggaagcaatgaaagaagatgatgaagaagatgag
cattccattaacacagcaaaaaacagagtttctgaacttcaaaaaagaaagcttgaatct
caagcaggcatatgtttaggagagtcacagggtccagtggagagaagcacgacaagcaat
gggtcaggcaaggacttagtgtttaattctgaatcggttcaaccaggcgacagccgaatt
cgtattttggattcctgttcacatccagaagaatctgaacatgatatggcaggagaaatg
agcactagccatatacagggctccattgatacttgcattgctcgatctggtgacttcctt
ggagaagccattggaaatgaactttttaattgcaggcggtttattggacctcaacatcac
caccaccaccatcatcatcatcaccaccatcatcatcatcaccaccaccatcaccaccac
caccatgaagggcacatggtggacgacatgctgagtgcagatgatgtcagctgcagtagc
tcacaagtcagtgcaaaatcagagaaaaacatggcagactttgatggtgaggagtctggc
tgcgaagaagaactggtacagattaattcacacgcagagcttacctctcatctccagcag
caccttcccaacctggcttctatttaccatgagcatctgagtcaaggcccttctgtacac
aagcaccagtacaatagcaatgccatggttgatataaacttggataatgtttgtaagaaa
ggcaatacactgctgtgggacctggtccaagatgatgatgcgattcacctctctgaaggc
ttaataaatgaagctgaaaagctgctctgttctctggtctgctggtttactgacaggcag
atcagaatgcggttcattgaaggctgtttggaaaaccttgctaataatagatctgttgtt
gtatcactccgacttcttcccaagttatttggaacctttcaacagtttggaagcagttat
gatacccactggataacaatgtgggcagaaaaggaactgaacatgatgaaactctttttt
gataacctagtacactacattcagtctatcagagatggacagcacaagcacgctctgtac
agccacagtgctgaagttcaagttcgtctgcagtttttaacttgtgttttttccacgttg
ggatcgccagatcatttcaggctaagtttagaacaggtagacattctttggcactgcctt
gtggaagacacagagtgctatgatgatgctctccactggtttttaaatcaggtccgtagc
aaagaccagcatgccatgggaatggagacttacaagcatctttttttagagaagatgcct
cagttgaaacctgaaaccattagtatgaccggtttaaacctttttcagcatttatgcaac
ttggctcgccttgcaactagtgcttatgatgggggatcaaattctgagttgtgcggcatg
gatcagttttggggaattgctttaagggcacatactggagatgtcagtcgtgcagcaatt
cagtatatcaactcatattacattaacggcaaaacaggattggagaaggagcatgaattt
attagtaaatgtatggagagccttatgatcgcttccagtaaccttgagcaggactctcaa
tcgagtctcactataattgaaaggggactcctaatgctaaagacccaccttgaagcattc
agacgaaggtttgcatatcatctaaggcagtggcaaatagaaggcactggcattagcagc
cacttgaaagcattaaatgacaagcagtcattaccgctaagaattgtgtgccagccagca
ggccttcctgataagatgactatagaaatgtacccaagtgatcaggtggctgacttgaga
gcggaagtgactcattggtacgagaatttgcaaaaagaccaaatgaaccagcaggcacaa
ctccaagagtttggacaaagcagtaggaaaggagatttccctggtggtctaatgggtcca
gtccgaatgatttcatctggtcatgaactgacaaccgattatgatgagaagacccttcat
gaacttggctttaaggatatgcagatggtgtttgtatctttgggtgccccacgccgagag
cgaaaaggcgaaggtgttcagctgcctgcatcatgcctaccgccacctcagaaagaaaac
atcccaatgcttctgctgcttcaagaacctcatctttctacgctctttggcttgttggaa
atgctggcttcttttaagcctccatctggagaaatggttatggaagatgttgagcatgca
aggtgtgaagagctgcatctccatgcagaaaacctatccaggcgcgtctgggagctgctc
atgctgcttcctacctgccccaacatgctgcaggcttttcagaatgtatcagatgagcag
ggaagtgatggaccttgttggaaagatttgcttaggataaaaagtgctcataaactccta
tatgctttagaaatcatcgaggctctgggaaagccaaacagaagaataaggagagaatcc
acgggtagttacagtgacttgtatccggattctgatgattcaagtgaagatcaaattgag
aacagtaaaaacacatggagctgcaagtttgtggctgcaggaggtctccaacaactgatt
gagatattcaattcaggaattttggaacctaaagaacaggaatcctggacagtatggcag
ctggactgtttagcatgtttgctaaagttgatctgccagtttgctgtggatccaacagac
ttggatctggcctatcatgatgtttttgcctggtctggtgtagcagaaagccacaggaaa
agggcttggcctgggaaatcaaggaagtctgcaggagaacatccaaagggccttcacata
ccacgtttaacggaggtatttttagtccttgtccaaggaacctgtttgattcagcggtta
atgtctgtagcttatacgtatgacaatatagcaccaagagtactgaaagcccagtcagat
cacaggtccaggcatgaagtaacacattattcaatgtggctcctggtcagctgggctcac
tgttgttctgtggtaaaatccagccttgccgacagtgataatttgcaagattggctcaaa
aaattaacccttcttattccagagactgcagttcgtcatgaagcgtgtaatggcttgtac
aagctttccctgtctggtcttgatggtggggactctataaatcgctctttcttgcttctg
gcagcatccaccttattaaagtttcttcctgatgcccaggctctgaaaccagtgcggatg
gaggactatgaggaagaaatgattttacgacctggatgtaaagaatatttttggttactg
tgtaaactgattgataatatccatgtcaaagatgccagccagacaacactacttgattta
gatgcccttgcacgacatttggccgactgtataagaagccgagagatctttgactaccag
gatggaaatgtagaagatgatggaatgactggtcttcttaggcttgcaaccagtgttatc
aaacataagcctccatttaagttttctagagagggtcaggagtttctcagagatgttttt
aatctccttttcttgctgccaagcctgaaagacaaattgcagccaaaatgtaaatctcat
tcttcccgagctgctgcttatgacctcctagtggaaatggtgaaaggctcagtggagaac
tacaggctgttacacaactgggtaatggcgcaacacatgcagtcttcccacgccccttat
aaatgggattattggccccatgatgatgtgcgagctgaatgccggtttgttggcctgact
aaccttggggcaacatgctatctggcttctaccattcagcagctctacatgatccctgag
gccaggcaagccatctttactgcaaagtattcagaggatatgaagcataaaacaactttg
ctggagctccaaaaaatgtttacatatttaatggaaagtgaatgcaaagcttacaatcca
aggccgttctgtaagacatacacaatggataaacaacctcttaatacaggggaacagaag
gacatgacagagttctttacagatcttataacaaaaattgaagaaatgtctcctgaactg
aaaaatactgtcaaaagcttatttgggggtgtcatcacaaataatgtggtgtccttggat
tgtgagcatgtaagtcagacagctgaagagttttacacagtcaggtgccaggtagcggat
atgaagaacatttatgaatctttggatgaagtcactatcaaggacactctggaaggtgac
aacatgtacacttgctctcactgcggcaagaaggtgcgagctgaaaagagagcctgcttt
aagaagctgccaagaatattaagctttaatacaatgaggtatacatttaatatggtcacc
atgatgaaagaaaaagtcaacacgcacttctctttcccacttcggctggatatgacccca
tatactgaagattttctgatggggaagaatgaccgaatagaaggctttaaagaagattgt
gaagagccaaagcagacagagagttatgagtatgatttaataggggtcactgttcacacc
ggaacggctgatggagggcactactatagcttcatccgagacatagtgaatcctcatgct
tataagaataataagtggtatctcttcaacgatgcagaagtgaagccttttgactctgct
cagctggcatctgagtgttttggtggtgaaatgacaacaaaaacttatgactctgtaact
gacaagtttatggacttctcatttgaaaagacccacagtgcatatatgctattctacaag
agggtggagccagaagaggaaactggaagggaattcaaatttgatgtctcctcagagctt
ctagagtggatctggcatgataacatgcagtttctgcaggataagaatatttttgagcat
acctattttgggtttatgtggcagctctgcagcagcattccaagtacattaccggacccc
aaagcagtttctctaatgacagcaaagcttagtacatcatttgtcctggagacttttatc
cattcaaaggagaagcccacaatgctccagtggattgagctgctaactaagcagtttaac
aacagccaagcagcttgtgagtggttcttggatcgcatggcagatgatgattggtggcct
atgcagattttgatcaaatgtccaaatcagattgtcagacagatgttccagcgtctttgt
attcatgtcattcagaggttgagaccagtacatgcgcatctgtatctgcagccaggcatg
gaagatggttctgatgacatggatggtcccgtggaagatataggcagccgctcctgtgtc
actcgctttgtgaagacattgctgtcaattatggaacatggcgtgaaacctcatagtaaa
catctgacggagtactttgcctttctatatgagtttgtcaaaatgggagaagaagagagc
cagttcctgctgtccctccaagcaatctcaaccatggtacatttttatatgggaaccaaa
ggaccagaaaatccccaggttgaagtgctttctgaagaggaggaaggtgaagaggaggaa
gaagaagatattctatcattagctgaagaaaagtatcgaccagctgctcttgaaaagatg
attgctctgatagctttcctggttgagcagtctcgctcagaaaggcatcttacattgtcc
cagaatgatatggctgcactaactggcggaaagggctttccgtttcttttccaacacata
cgagatgggattaacatcagacaaacttgcaatctcattttcagcctttgtagatataat
aatcgtcttgcagagcatattgcatctatgctgtttacgtcaattgcaaagctgacacct
gaggctgcaaaccctttctttaagctgctaaccatgatcatggagtttgctggaggtccc
cctgggatgccaccttttgcttcctacattttacaaaggatatgggaggttatagaatac
aacccttctcaatgtctggattggctggcagtgcagactcctcgcaacaagttggcacac
aactgggtattacagaacatggagaactgggtggagcggttcttacttgcccacaactat
cccagagttagaacctctgcagcctacctgttggtgtcactaattccaagcaactcgttc
cgacagatgttccgatctacccgttcccttcacattcccacaagagatttaccccttagt
ccagacacaactgtggtacttcaccaagtatacaatgcccttctaggccttctttcaaga
gcgaaactgtatgttgatgctgctgcacatggtacaacaaagttggttccttactttagc
ttcatgacttattgcttgatctcgaaaacggaaaagctcatgttttccacatattttatg
gacctgtggaatcttttccaacccaagctgtctgagccagctattgctacaaaccacaac
aagcaagccttgctctccttctggtacaacgtctgcgtggactgccccgaaaatgtacgc
cttattgttcagaatcccgtggtgactaaaaatatcgcctttaactatattctggctgac
cacgatgaccaggatgtagtactgtttaaccgcgggatgctgccagcttactatggcatt
cttcggatgtgctgcgagcagtctcctgcctttacccgtcagcttgcctcacaccagaac
attcagtgggcctttaaaaacctcaccccgcatgccagccagtacccagcggctgtggaa
gagctttttaacctcatgcagctctttgtagctcagaggccagatatgagagaggaagaa
ctggaagatataaaacagtttaagaaaactactatcagctgctatttgcgttgtttagat
gggcgttcctgctggacaactttaataagtgcctttagaatattgctggaatctgatgaa
gacagattgcttgttgtatttaacagaggattaatcttaatgacagagtcctttaacacc
ttgcacatgatgtatcacgaggctacagcctgtcatgtaactggagacttggtggaactt
ttgtctatatttctgtctgtccttaaatctacccgcccctacctgcagagaaaagacgtt
aaacaggccttgattcagtggcaagaaagaatcgaatttgcacacaagctcctaacattg
ttaaattcctacagtcccccagaactaagaaatgcctgcatagatgtgctgaaagaactt
gtactgctgagccctcatgattttttgcacactctggtcccatttctacagcacaatcat
tgtacataccatcacagtaacatcccaatgtcgcttggtccctacttcccctgtcgtgag
aacatgaaactaattggagcaaaaagcaatatccgtccacctcgtcctgagctgaacatg
tgcctcttgcccacaatggttgaatccaataagggtaaagatgatgtatatgatcgcatg
ctgctagattacctttcttcctaccatcagtttattcatctgctctgccgcgttgccatc
aactgcgaaaagtttacagaaactctaattaagctaagtgtcttaattgcatatgaagga
ctctccctgcatcttgcattatttcccaagctctggacggagctgtgccaaactcagtcg
gcaatggctaaaagctgcacaaaactgctgtgtgaagatccagtttttgccgagtatatt
aaatgcattttaatggatgaaagacttttcctcaataacagcatcgtctacacattctta
acccatttccttggaaaggttcaaagtcaagtgttctccgaaacgaactgcgcaaacctt
atgaatacaataattacaaacctcatcaatcagtatcaaaacgtcgaatcagatttcggc
aacagagttgatatttccaaagcaagcagcactttaaatggggatcttcgagcactcgct
ctgctcctttcggtccacactcccaaacagcttaacacagccttaatcccgactctgcaa
gaactcctgagcaaatgcagagcctgtcagcaacagagaaactcattacaagagcaagaa
gccaaagaaggtaaaactaaagatgatgaaggtgctactccagtgaaaaggagacgggtt
agcagcgatgaggagcatatggtcgatagctgcatcagtgatcttaagaacgaccgagaa
gtttccaccccaacaagcacatcagacaacgaaacaagggactcttccatcattgatcca
ggaactgagcaagatccaccttcccctgaaaatagctcttctaaggaattcagaatagaa
gtctcctcttccttctcagaagatctaatgctgtcttcaaggccgcagcaagtggaagac
caaactggcagcagcagtaaatttgaagatagcaaggaaatgaaggaccttcagagtccc
aaggacgctacggtgactgacgaagacaatgagcttccttccacctccatttccgcagtg
ctggctgacttagcagatctgaggagctgtgatgctcaaacgttgtcctctaacgatcca
gatctaagcctttctctcaattgtgaccattccaggggactttttagtcatgtacaacaa
aacgacattttagacaccttgtgcaggaccattgagtccactattcttgtggtctcaagg
atatcaggaaaagaaaacaaagctgcttcttga

DBGET integrated database retrieval system