KEGG   Xenopus tropicalis (western clawed frog): 100490477Help
Entry
100490477         CDS       T01011                                 

Definition
cytochrome P450 1B1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100490477
  Amino acid metabolism
   00380 Tryptophan metabolism
    100490477
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100490477
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100490477
Cytochrome P450 [BR:xtr00199]
 Cytochrome P450, animal type
  CYP1 family
   100490477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 550 aa AA seqDB search
MNWKIWEDLGQSSVPKLLLSFLCALTVAHILKWIHEWIIPRWIRSSQPPGPFPWPLFGNA
LQMGSYPHLAFIDLAKRYGNIFQIKLGSQKIVVLNGDLVIRHALLHKGEDFAGRPKFTSY
QFVSGGRSLAFGCYTEKWKAHRKLAHSTVRAFSTGNPQTKRCLAENVLKEARDLIALFSE
LGQGGKYFYPGRHTVVSVANVMSAVCFGRRYQHGDLEFQSLLSNNDKFTRSVGAGSLVDV
MPWLQRFPNPVRSVFRSFQQVNYEFYDFVYKKFLLHRNTANQAVTRDMMDAFIHILITKE
GKVRADDADGGEEKGKNGQYFFHSLEAEHVPSTVTDIFGASQDTLSTALQWVIFFLVRYP
EIQTKLQDEMDRVIGKDRLPCIEDQPKLPYLMAFLYEFMRFSSFVPITIPHATTKNTTIM
GYQIPKDTVVFVNQWSVNHDPQKWSNPGEFNPSRFLDDNGLINKDLVSNIMIFSVGKRRC
IGEELSKIQLFMFSSILLHQCIFTALPADNLNPKGDYGLSIKPKPFRISMTLRHGSMDLL
NNSVLSGMAE
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaattggaagatatgggaggaccttggccagtcctctgtacccaagctcctgctctcc
ttcctctgcgccttgactgttgctcacatcttgaagtggatccatgaatggataatccct
aggtggatcagatcttctcaaccccctggtcctttcccctggccgctgtttggcaatgcc
ttgcagatgggcagttaccctcatctggccttcatagatttagccaagcgctatggcaac
atctttcagatcaagctgggaagccagaagatagtggtgctgaatggagacttggtcatt
cgccatgccctgctgcacaagggggaggattttgctgggcgcccgaaatttacctcctac
cagtttgtgtcagggggccgcagcctggctttcgggtgctatactgaaaagtggaaagcc
caccgcaaactagcgcactccactgtgcgagcattttccactgggaaccctcagaccaag
cgatgtttggcggagaatgtactaaaggaggcacgtgacctcattgcgctctttagtgag
ctggggcaagggggcaagtacttttaccccggaagacacactgtagtgagtgtggctaat
gttatgagcgcagtgtgttttggaaggcgctaccaacacggggaccttgagttccagtcc
ctactgagcaacaatgacaagttcacaaggagtgtgggggctggcagcttggtggatgtg
atgccctggctccagcgcttccccaacccggtcaggagcgtcttcaggagcttccagcag
gtcaactacgagttctacgactttgtctataaaaagtttttgctgcatcgaaacacggcg
aatcaggcagtcaccagggatatgatggatgccttcatccacatcctcattaccaaggag
ggaaaggtcagggcagatgatgctgatggaggagaagagaaaggaaagaatggacaatac
ttttttcactcgctggaggccgagcatgtgccatctacagtcactgatatattcggtgcc
agccaggacactctgtccacagctctacagtgggtcatattcttcctggtcagataccca
gaaattcaaactaagctgcaagatgaaatggacagagttattggtaaagatcgcttgcca
tgtatagaagaccaaccaaaattaccctacttaatggcattcctttacgagtttatgcgt
ttcagcagctttgttcctatcactattccccatgcaaccacaaagaataccactataatg
ggctaccagattccaaaagatactgtggtatttgtcaatcagtggtccgtcaatcacgat
ccacagaaatggtccaacccaggagaatttaacccttctcgattcctagatgacaatgga
ctcattaataaagacctggtaagcaacatcatgatcttctcagttggcaaacgaagatgc
attggcgaggagctatcaaagatacagttatttatgttctcctcaatcttattgcatcag
tgtatattcacagcattgccggcagataatctgaatcccaagggtgactatggactaagc
attaagcccaaacctttcagaatcagcatgacactgcggcacggcagcatggacttgctg
aataatagtgtgcttagtgggatggccgagtaa

DBGET integrated database retrieval system