KEGG   Xenopus tropicalis (western clawed frog): 100490673Help
Entry
100490673         CDS       T01011                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100490673
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100490673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 600 aa AA seqDB search
MALVPIAQLCLCTLSLLLVPALTQSDGGLLVSTRSGKVRGLRQPVLSTHVSAFLGIPFAE
PPVDKMRFRRSEPKKPWTDVWDATAYPNACYQYFDTLYPGFPGMEMWNPNRPMSEDCLYL
NIWVPHPRPSNATVMVWIYGGGFYSGSSSLDVYDGRYLCHAENVIVVSMNYRVGAFGFLT
LTPGSVDAPGNVGLFDQRLALQWVQDNIAFFGGDPRTVTIFGESAGAVSVGMHVLSPGSH
HLFSKAALQSGSPNTPWATITPQEARRRTELLGKFLDCRMGNDTELLNCLRVKQPQELID
HEFSVLPAPSVFRFAFVPVPDADFFPEPPEILMNMGRFKPCPLIMGVNQNEGSYFLLYGA
PGFSKNNESLITREEFLGGVKMSVPQANDIALEAVVMQYTDWADEHAGVKNREAMDQLVG
DHNVICPLTYFAGKVAETGNRVYTYFFDHRASNLAWPQWMGVPHGYEIEFVFGLPLDANL
NYTPQEEALSRRMMRYWANFARTGDPNEGNDAHQPRWPLYTASEQRYMALNNKPYQELQG
IRVQTCMFWNRFLPKLLNITDNIDEAERQWKVEFHRWSTYMMRWKNQFDHYSKQERCSEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgtacccattgctcagctgtgcctctgcacactctctctcctcctggttcct
gcgctcacacagagcgatggcggtctcctggtcagcactcgttcggggaaagtgcgtggc
ctgaggcaacctgtcctttctacccatgtaagtgccttcctgggcattccctttgccgaa
ccaccggtggacaaaatgcgcttccgacgttcggagcccaagaaaccatggacagatgtt
tgggacgcgacagcctaccctaatgcctgctatcaatattttgatactttgtatcctggt
ttccctggcatggaaatgtggaatcccaaccggccaatgagcgaagattgcctgtatctt
aacatctgggtcccccacccacgtccctccaatgctaccgttatggtatggatatatggt
ggaggtttctacagcggctcctcttctctcgacgtttatgatggacgctacctgtgccat
gctgagaatgtcattgtggtctccatgaattaccgcgttggagcttttggttttctgacc
ctgacaccgggtagtgtagatgcccctggcaacgttggcttgtttgatcagcgtcttgct
ctccagtgggttcaggacaatatcgccttctttggtggagatcccaggaccgtcacaatt
tttggggaaagtgccggagctgtctccgtgggtatgcacgtcctttcccctggaagccac
catctcttctccaaggctgccttgcaaagtggctcacccaacacgccctgggctacaatc
accccacaagaagctaggcgccgcacagagctcctgggaaagtttttggattgcagaatg
ggaaatgatacagagttactgaactgtctaagagtcaagcaaccgcaggaattaattgac
catgaattctctgtacttccagcccccagtgtctttcgttttgccttcgtaccggtgcca
gacgcagactttttcccagagcctcctgagatcttgatgaatatgggcagatttaagcct
tgccccttgataatgggagtcaaccagaatgaaggatcgtactttctgttgtatggggcc
cctggctttagcaagaacaacgagagcctcatcactcgagaagagttcctcggtggggtc
aagatgagtgttccacaagccaacgacattgccctggaggcggtagtgatgcagtacaca
gactgggcagatgaacatgctggggtcaagaacagagaggccatggaccagctggtggga
gaccataatgtcatttgccccctcacttattttgccgggaaggttgctgagaccggaaac
cgggtgtatacttatttctttgaccaccgggcgtccaacctggcttggccgcagtggatg
ggggtcccacatggatacgaaattgaatttgtcttcggccttcccctggatgcaaatttg
aactacaccccccaggaagaagctctgagccgcaggatgatgagatactgggctaacttt
gcacggactggtgacccaaacgagggcaacgacgcccaccaaccgcgctggcccttgtac
acggcctctgagcagaggtatatggccctcaataacaagccataccaggagctgcagggt
atccgagtccaaacgtgtatgttctggaaccgcttcttgcctaaactgctcaacatcaca
gacaatatagatgaggccgagcggcagtggaaggtggagttccatcgctggagcacctac
atgatgcggtggaaaaaccagttcgaccattacagcaagcaggagcgctgcagcgagctg
tga

DBGET integrated database retrieval system