KEGG   Xenopus tropicalis (western clawed frog): 100490768Help
Entry
100490768         CDS       T01011                                 

Gene name
grik4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100490768 (grik4)
Ion channels [BR:xtr04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100490768 (grik4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 958 aa AA seqDB search
MPRVLAPMVLVLLWLMKSAGSPSLRIAAILDDPMECSRGERLSITLAKNRINRAPERQGK
ARLEVDIFELLKDSEYETAETMCQILPKGVLGVLGPSYSPSSSSIISNICGEKEVPHIKV
STEEFLRFQYQRFTTLNLHPSNTDISAAVATLLRFFNSTTACLICAKAECLLNLEKLLRQ
FLISKDCLSVRMLDDTWDPTPLLKEIRDDKTSTIIVHANASMSHTILMKAAELGMVTAYY
TYIFTNLEFVLQRFESPLDDRVNILGFSMFNQSHSYFKEFAHTLQQSWEENCDHSPFTGP
ALSAALLFDAVYGIVSAVQELNRSQEIGVKPLSCGSSQIWQHGTSLMNYLRMVELEGLTG
HVEFNSKGQRSNYDMKIMQYTKTGFQEIGQWHVTNGLNMDKRYFSKNASDTLVNKTLIVT
TILENPYLMLKANHQELEGNDRYEGFCVDMLKELAAILRFNYKIRLVADGVYGVPELNGT
WTGMVGELISRKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPV
GGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLAD
QTTIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMHSKQPSVFVKSTEEGIARVLNSNYAFL
LESTMNEYYRQRNCNLTQVGGLLDTKGYGIGMPVGSAFRDEFDLAILQLQENNCLEDLKR
KWWDGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAILIAMLEFLWTVRNAEDSEVSV
CQEMASELSSIILCKDSFLPRRRRGGVIRGRPITQDDRRGRNTSILSNGKLCGGSGPDPL
TQRLAQEAALVARGCTHIRVCPECRRFQGLRARTSVGSPAQSEDSLEWEKTTNSSEPE
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgtcctggcgcctatggtgctcgttctcctgtggctgatgaaatctgctggt
agcccctccctacgcatagctgcgattctggatgatcccatggaatgcagcagaggagag
aggctgtccataacattggccaagaaccgtattaaccgggcaccagaacggcaaggcaaa
gcaagactagaggtggacatttttgagctactgaaagacagcgagtatgagactgcagaa
accatgtgccagattctgcctaagggtgttttgggtgtattgggcccatcttacagccct
tcatcgagttccatcataagcaacatctgtggggagaaggaggtaccacatataaaagtc
tctactgaagaattcctaagatttcagtaccagagatttactactttgaaccttcatccc
agcaacactgacattagtgcggctgtagcaactctgctccggtttttcaacagcaccact
gcctgtctcatctgtgctaaggcagagtgtctgttgaacctggagaagttgctccgtcag
tttctcatctccaaggattgtttgtcagtgaggatgcttgatgatacctgggatcctact
ccgcttttgaaggagatccgagatgacaagaccagcactatcattgtccatgccaatgct
tcaatgtcgcacacaattctgatgaaggcagctgagctgggaatggtgacagcttattac
acgtacatctttactaatctggaatttgtattgcaacgattcgagtctccattggatgat
cgtgtgaatattttaggtttttccatgttcaatcaatcacacagctacttcaaagaattt
gcacacacgcttcaacagtcctgggaggagaactgcgatcactcccctttcactggtcct
gctctttcagctgctttgctttttgatgcagtttatggaatagtgagtgcagtacaagaa
ttaaaccgaagtcaggagattggagtcaagcctctgtcctgtggttcttcccaaatctgg
caacatggcacaagccttatgaactacttgagaatggtagagttggaaggtctcactggc
cacgtggaattcaatagcaaaggacaaaggtcaaactatgatatgaagatcatgcagtac
acgaagactggctttcaggagattggacaatggcacgtcacaaatggtctcaacatggat
aagagatatttttcaaaaaatgcctcagacactttggttaacaagacccttatagtcaca
actatcctagaaaatccatacctcatgttgaaagcaaaccatcaggaattagagggtaac
gaccggtatgaaggtttttgtgtagacatgctaaaggagcttgctgccatcctgcgattc
aattacaaaatccgcctggttgctgatggtgtttatggtgtcccagagctgaatggcacc
tggactggcatggttggagagctaatttccaggaaagcagatttggctgttgcaggcctc
acaattacagctgaaagagagaaggtgattgatttctccaaaccattcatgactttagga
atcagcatcttgtaccgcgttcatatgggacggaagcctggctatttctctttccttgat
cccttctctcctggtgtgtggctcttcatgcttcttgcctatttagctgtcagctgtgtg
ctgttcctggtagctcgcttaactccatatgaatggtacagtcctcacccatgtgcacag
ggaaggtgcaatcttctagtgaatcagtactcccttgggaatagcctttggtttcctgta
gggggatttatgcagcaaggatctacaattgcaccaagagctctgtctacccgctgcgtc
agtggtgtctggtgggcatttaccctgataattatttcatcgtatacagccaatcttgct
gcatttctcactgtgcaaagaatggatgtccccattgagtcagtggatgacctggcagac
cagaccacaatcgaatatggtacaattcatggcggctccagcatgaccttcttccaaaat
tctcgctatcaaacctatcagcgaatgtggaattacatgcactcaaagcagcccagtgta
tttgtcaagagcacagaggagggaatcgcaagggtgttgaactctaactatgcctttcta
ctggaatccactatgaatgagtattatcggcaacgaaactgtaaccttactcaggttggt
ggtctgctggataccaagggctacggcattggcatgccagtaggctctgctttccgtgat
gagtttgaccttgcaatccttcaactgcaagaaaacaattgtctggaggacctgaaacga
aaatggtgggatggaggcaaatgcccaaaggaggaggaccacagagcaaaaggtctggga
atggaaaacattggtggtatatttgtggtattaatatgtgggcttatcgtagctatttta
atcgcaatgctggagtttctttggactgtacggaatgctgaggatagtgaggtttctgtg
tgccaagagatggcatcagagctaagcagcattatcctttgcaaggacagctttctgcct
cgtcggaggcgcgggggagtgatacgtggcagacctataactcaagatgatagacgggga
cgtaatactagcattctaagcaatggtaaactgtgtggaggcagtggaccagacccacta
acacagagactggcacaggaagcagcattggtagccagaggatgtacgcacattcgagta
tgccccgagtgccgtcgcttccagggtctcagagctcgaacttctgtaggttctccagca
caaagtgaggacagtttagagtgggagaagacaacaaacagcagtgagccggaatag

DBGET integrated database retrieval system