KEGG   Xenopus tropicalis (western clawed frog): 100491268Help
Entry
100491268         CDS       T01011                                 

Gene name
st6gal1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:xtr00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:xtr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 473 aa AA seqDB search
MARCISKFGVISIILCTFSFFLLDFYSKSKCLESCTTVHGKVEVARDVKNNLNKALEREN
PLEREKDLEREKQLERQKELEREKQLKRERELEREKQLERERELEREKQLEREKQLEREK
QLEREKELERQKIAEAEHLHKIWLNQRQGAQSRLRFANRYGVWNEHMSSKDILPRLVMVK
KSYQSENKYKVKYQGKLGQLLTPQELLCAIKTKVNISTLVTADLPQNADSWSQYLPRKTL
QEEVKSLGKCAVVSSAGSIKHSRLGQEIDTHDAVLRFNAAPVLGYQDDVGTKTTFRLLNS
QLVSRPELKFLEDPLYKEGSLIMWDPAPYNANVEEWHKNPDYKFFERYSEYRRRNPEQMF
YVLNPHAAWQLWDIIQQNAPEDINPGPPSSGLLGILLMMNLCDQVNVYEFLPSRRQSDLC
HYYERYQDRACTLGAYHPLMYEKNLVKKLNLGDDNSIFHFGRITLPGLRGLQC
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctgcattagtaagttcggtgtcatatccatcatactttgcacttttagtttc
tttttgttggacttctatagtaaatccaaatgtctggagagctgcacaacagtgcatgga
aaggtggaggtggcccgggatgtaaagaataatttaaacaaagcacttgaaagggaaaac
cctcttgaaagagaaaaagacctcgaacgggaaaaacagctcgaaaggcaaaaggagctt
gaaagggaaaaacagctcaaaagggaaagggagcttgaaagggaaaaacagctcgaaagg
gaaagggagcttgaaagggaaaaacagctcgaaagggaaaaacaactcgaaagggaaaaa
caactcgaaagggaaaaggagctcgaaaggcaaaaaatagctgaagcagaacatttacat
aaaatctggctcaatcagaggcaaggtgcccaatcaagattgagattcgctaataggtac
ggagtatggaatgagcacatgtcatcaaaggacatactacctagactggtgatggtgaag
aagtcctaccaatcagagaacaaatacaaggtcaaatatcagggaaaactcggtcagctg
ttaacaccacaagaactgctgtgtgcgataaaaacaaaagtgaatataagtacccttgtg
acagctgaccttccccagaatgccgactcctggagccagtacttgcccagaaagactctg
caggaagaagttaagagcctggggaaatgtgctgtggtgtcctctgcaggatcgattaaa
cactcaagacttggacaggagattgatacccatgatgctgttttgaggtttaacgctgcg
ccagttttaggatatcaggatgatgtcggaacaaaaacgactttccgtctgcttaattcc
cagcttgtttctcgtcctgagcttaaattcttagaagatcctctgtataaggaaggctcc
ttaattatgtgggatccagcaccgtataatgcaaacgtggaagagtggcacaagaaccca
gactataagttctttgaaaggtatagtgagtatcgaaggaggaacccagagcagatgttc
tatgtcctaaacccacatgcagcatggcagctgtgggacataattcagcagaacgcacct
gaagacattaatccgggccctccttcatctggcttattagggattctgctgatgatgaac
ctctgtgaccaagtaaatgtttatgaatttctgccgtccagacgacagagtgatttgtgc
cactattatgagagataccaagatcgtgcctgcaccttgggagcataccaccctctcatg
tatgagaagaacctggtcaaaaagctcaatcttggggacgataacagcatattccacttc
ggaaggattactctgccaggactcagggggctgcaatgctag

DBGET integrated database retrieval system