KEGG   Xenopus tropicalis (western clawed frog): 100491277Help
Entry
100491277         CDS       T01011                                 

Gene name
gtf3c4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100491277 (gtf3c4)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100491277 (gtf3c4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 775 aa AA seqDB search
MAGEGKGAEGEEPSHSFRLTITKREPAVRLLHTVTGLEPLAWSEDHRLSVCTGRSLCFLE
LFWDINGCSQELTLHRTCVPAPASTCTLKVGKEKEVEDCKEMFARSKTLTVSQSFMLDRV
FNPEGKFLPSFQGFKYASWSPIGCDANGRCLVAALTLDNRLTIHANINRLHWRQLVDLTE
LYGQHLFESNYRVSGDETPHAGLDDFTEFKRRHSMQTPVRMEWSGICISQQITENNECVD
QSTVLLAVLFENGDVAVWQLRLPFLGKESITSCNTIVSGISSPSVLAWWEYEHSNRKMSG
LIIGSRLGPIKIIPVNLKAVKGYFTLRQPVILWQEADLLPVHGIKCIGLYHPYQNCRCSL
VVAARGCYLFWCLLLISKAGLNVHNSHVTGLHSLPIISMSVDKQNGTIYTCSVDGKVQQL
IPIFTEVALKFEHQLINLSDMFGPVKSHAITVSPGGAYLACITTEGMSRGIHPMTKTYLV
HFVALKSFEEAAAQLLECSSQNLFSQMDLTDLVRWKILKDKMIPQFLQEALDKKIEGGSL
YFWRFRLFLLRVWYQSLQKASNELTWKPPPKEEKAAKLDDPTATDEKDDQQDAGPESPSK
ETSENSPADVTREADGGAAEDGLLEIQEKIGSAEWHLVREHMKQVLGEVYLHTWIAQNTS
VPTRGICDFLTSKDSDDRAVQVIIGHLEKKMNKQKFPEHCILCKEVLPFNDPKQALCPNG
HVWPRCFLTYQACQSLLYRRCLLHDSIARHPAPKDPDWMKKLLNYPCILCDSPVF
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggaagggaagggagcggagggtgaggagcccagtcacagctttaggctcact
ataaccaagcgggagccggcggtgaggctgctgcacactgtgaccgggctggagcccctg
gcttggtcggaggatcaccgcttgtctgtgtgtaccggccgcagcctctgcttcctggag
ctgttctgggatatcaatggctgctcccaggaactcaccctgcaccgcacctgtgtgccc
gcccctgcctccacttgcaccctcaaggttggcaaagagaaggaagttgaagactgcaag
gaaatgtttgcgaggtcgaagacgctgacagtcagccagtcctttatgctggatcgggtg
tttaaccctgaagggaagttcttaccgtctttccaagggtttaaatacgccagctggtct
cctattggttgcgacgccaatggccgatgccttgtggcagccctcaccttggacaacagg
ctgaccattcacgccaatattaaccggctgcactggagacagctagttgatttaaccgaa
ctgtatgggcagcacctgtttgagagcaactacagagtaagcggggacgagaccccccac
gcgggcctggatgactttactgagttcaagaggcggcacagcatgcagacccccgtgaga
atggaatggtcggggatctgtatcagtcaacagatcacggagaataacgagtgcgtggat
cagagcacggtactcctggctgtactcttcgagaatggagacgttgcagtgtggcagctc
cggctgccctttctgggcaaggaatccatcacttcttgcaacaccattgtatcgggaata
tcttcccccagtgttctggcgtggtgggaatacgagcacagcaatcggaaaatgagcggc
ctcattatcgggagccgtttgggccccattaaaatcatcccagtgaacttaaaggcagtg
aagggttacttcactctacggcagcctgtgatcctttggcaagaagccgacttgctgccc
gtacacggcattaaatgcataggactttatcatccgtaccagaactgccgctgcagcctt
gtcgtcgctgcccgggggtgctatttattttggtgtttgctgctcatatccaaagccggt
ttgaacgttcacaattcccacgtaaccggacttcactcgttgccgatcatatccatgtcg
gtggataaacagaacggcaccatttatacgtgctccgtcgacggcaaagtccaacagctc
attcctatttttacggaggtggctttaaagttcgagcaccagttgatcaacttgtcggat
atgtttggccccgtcaagtcccacgccattacggtcagccctggtggcgcctacctcgct
tgcatcaccactgaaggcatgagtaggggcattcatccgatgaccaagacgtacctggtt
cattttgtcgctcttaagagtttcgaagaggctgcagcccaactcttggaatgctccagc
caaaacctcttcagccagatggatctaacagacctggtgaggtggaagatcttaaaagat
aagatgatccctcagtttctgcaagaggcgttggataaaaagattgaaggtggctccttg
tatttctggcgtttccgcttgtttttgctcagggtttggtaccagtcccttcaaaaggcc
tccaatgaattaacatggaaacccccgccaaaagaagagaaagcggcaaagctcgacgac
ccaacggcgactgacgaaaaagacgatcagcaagacgccgggccggaaagtccttcaaag
gaaaccagcgagaatagccctgctgacgttaccagagaggcggacggcggagcggcagaa
gacggcttgctggagatccaggagaagatcggctcggcggagtggcacttagtacgggaa
cacatgaaacaagtgttgggggaagtttatctgcacacgtggattgcgcagaataccagc
gttcccactaggggtatctgtgactttctgacttctaaagactcggatgatcgagcagtt
caggtgatcatcgggcacctagagaagaagatgaacaagcagaagttcccagagcactgc
attctgtgtaaagaagtgttgccctttaatgacccaaagcaggctctttgccccaatggg
catgtatggcccagatgtttccttacataccaggcctgtcagagcctcctgtaccgacgg
tgcttgctgcacgacagcatcgccagacatccggcacccaaagatccagattggatgaag
aagctgttgaattatccatgcatactgtgtgactcccctgtattctag

DBGET integrated database retrieval system