KEGG   Xenopus tropicalis (western clawed frog): 100491566Help
Entry
100491566         CDS       T01011                                 

Gene name
prlr
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100491566 (prlr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100491566 (prlr)
   04060 Cytokine-cytokine receptor interaction
    100491566 (prlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 607 aa AA seqDB search
MPQNLAPTTPSLAVTFLLFLYTVSLNGQSPPGKPDIIKCRSFEKVTFSCWWKPGSDGGLP
TNYSLLYRKENDPKVYECPDYETSGPNSCYFDKAHTSFWIFYHIYVNATNALGSNVSDEE
SVDTTYIVQPYPPINVSLTVESGRYDLLAKWLPPAMADVQSGWLTLKYEVRLKEEKEQEW
EAHSVGNQLKLRLYGLIPGGNYVVQVRCKPDSGHWSEWSPESYVQIPGGGKKTDLTLWIS
VGALSAVICLTMIWTMALKRCSLMSCILPPVPGPKIMGFDTQLLKSGKSDELLSALGCQG
FPPTSDYEDLLVEFLEVDDSKQHLMSCHERSQQKQNIKVCPADTDNDSGRGSCDSPFSHS
EGCKELRPLQPGVESTDRGTHDHWPPENTIIDGSFTNFADGKSNMWPDVPLPGNQIAKSS
YQDIKDITNLAFSAMNASGHALLIPRDDKNQLRFFKTIETTDEEKYTKPSDFADLRSKGV
DADTVHLLPNEKPPFMPARTMDYVEVHKVNQNNALSLIPKHNENSARTDQYSVLVPNREY
TKVERVEGNNVLVLMQEMVNQVSPVTMEPTKLKFQQSQVANPMDMFSPESRTQAGGMGYM
DPSAFLS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaacttggcacctaccaccccatcactggctgtcacatttcttctctttctc
tacacagtgtcactcaacggacagtctccacctggaaaacccgatatcattaaatgccgc
tccttcgaaaaagtgactttttcctgctggtggaaaccgggctcggatggagggcttcca
accaactacagcctgctctacagaaaagaaaatgacccaaaagtatacgaatgcccagac
tacgagacctccggcccaaactcttgctactttgacaaagcacacacttcgttttggatc
ttttatcacatctatgtgaatgccaccaatgccctgggcagcaatgtgtctgatgaagag
agcgtggatacaacttacatagttcagccatacccacctataaatgtgtcacttaccgtg
gaaagtgggcgctatgacctgttagcaaaatggcttccacctgccatggctgacgtgcag
tctggatggttaaccctcaagtacgaagtgcgattaaaagaagagaaagaacaggaatgg
gaggcacattcagttggcaatcagttaaaactgagactatatggtttaatcccaggagga
aattatgttgtccaagtccgatgcaaaccagattcggggcattggagtgaatggagccca
gaaagttatgtacagatccctggtggtggaaagaaaacagacttgacactgtggatatca
gttggtgcattatcagctgtgatttgcttgacaatgatctggactatggcgttaaaaaga
tgcagtttgatgtcttgtatattgccacctgtgcctggaccaaaaattatgggatttgac
actcagctcttaaagagtgggaaatctgatgagcttttgagtgctcttggctgtcaaggt
tttcctccgacatcagactatgaagatcttctagtggagttcctagaagtggacgacagc
aagcagcatctcatgtcatgtcatgaacgatcacaacaaaagcaaaatattaaagtctgc
ccagccgatacggacaatgactccgggagaggaagctgtgacagccccttttcccattct
gaaggttgcaaagagcttcggccccttcagccaggagtcgaaagtacagacagaggaacg
catgaccactggccgccggagaatacaataatcgatgggtcatttacaaattttgctgat
ggcaagtcaaacatgtggccagatgttccgttgcctgggaaccaaattgcaaagtcatcc
tatcaggatataaaagacattactaacctggcttttagtgccatgaatgccagcgggcat
gcccttttgattccacgtgatgacaagaaccagctaagattcttcaaaaccatagagacc
actgatgaagagaaatacacaaagccaagtgactttgcagacctgcgatccaaaggtgtc
gacgcagacacagtgcacttgttgcccaatgaaaagcctccctttatgcctgctagaact
atggactacgtggaagtccacaaagtcaaccaaaacaatgcattatcgctcataccaaaa
cacaacgaaaacagcgccaggactgaccaatattctgttctggttcccaacagggaatat
acaaaagtggagagggtggagggtaacaatgttttagtgttaatgcaagagatggtcaat
caggtcagtcctgtaaccatggaacctacaaaactgaagtttcagcaaagccaagtggca
aatcctatggacatgttctcgccagaaagtcgaactcaggccggtgggatgggttacatg
gatccttcggcttttctctcttaa

DBGET integrated database retrieval system