KEGG   Xenopus tropicalis (western clawed frog): 100492247Help
Entry
100492247         CDS       T01011                                 

Gene name
dbh
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xtr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 615 aa AA seqDB search
MAKRRFCSFSNLRIREVVPVYFTMLAVFMILLVASLQGPSRQQKSSFPYQVPLDPQGSLQ
LYWNVSYSEKVVYFRILIKDLKFGLIFGMSDRGDFEDADMAVLWTNELGSFFGDAWSDQK
GQLHMDSQQDYELLNAQQSQEGLYLLFRRPFATCDPKDYLIEDGTVHLIYALLEKPFSTL
SSIDVSAIKNRGLQRVQLLKPDLPIPRLPADVLNMEVRAPQVLIPAKETTYWCHITELPK
DFTKHHIVMYEPVITKGHEAIVHHIEVFQCASNYYTIPRYDGPCDSKMKPQSLNSCRHVL
AAWAMGAKAFYYPEESGLAFGGPDSSRYLRLEVHYHNPLELKGLRDSSGIRLYYTSTLRR
YDAGIMEVGLVYSPVMAIPPGQKDFLLTGYCTDKCTDRALPSNGIKIFASQLHTHLGGRG
VPPILVREGKEAEVVNADGHYSPHFQEIRMLKKAVHVLPGDVMVTSCSYNTEDRKNITVG
GFSITDEMCVNYVHYYPRTDLELCKSMVDPGYLQKYFHMVNRFNSDDVSTSPNTTVTKQF
QEVPWNSFSAGVLKSLYSFAPISMHCNRSSAVRFPGEWEKQPLPQINEKLPSPPATCPAM
DPAKSKGPTLVRLLQ
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagaaggttctgctccttctccaacctcaggatcagggaggtggtccctgtc
tatttcacaatgttggccgtctttatgattctcctggtggcctcgctacagggcccatcc
cggcagcagaagtcatccttcccttaccaggtaccactggatccccaaggttctctccaa
ctctactggaatgttagttactccgaaaaagtggtctacttccggatcctgattaaagac
ctgaaattcgggctgatttttgggatgtcggacagaggagactttgaagatgccgacatg
gccgtgctctggaccaatgaactgggctctttctttggagatgcctggagtgaccaaaag
gggcaactccacatggattcccaacaagactatgaactgctgaatgcccaacagtctcag
gagggtctctatcttctctttagaagaccatttgccacgtgtgatccaaaggattatcta
atagaggatgggaccgttcatttaatctatgctctgcttgagaagccattctccactctt
tcttctattgatgtctctgccataaaaaatcggggacttcagagagttcaactcctcaag
ccagacctgcccattcccagactcccagcagatgtcctcaacatggaagtcagggccccc
caggttttgattccagccaaagaaaccacctactggtgccatatcacggagcttcctaaa
gactttacgaagcaccacattgtcatgtacgagcctgtgattacaaagggacatgaagcc
atcgtccatcacattgaggtcttccaatgtgcctcgaactactacaccattccccgatac
gatggaccatgtgactccaagatgaaaccccaaagcttgaactcttgtcgccacgtcttg
gctgcctgggcaatgggagctaaggctttttactacccagaagaaagtggtttggccttt
ggtgggcctgattcttctagataccttcggctggaggtccattatcataatcctctggag
ttaaaaggtctcagggactcttctggaattcgactttattacacctcgaccctaagaaga
tacgatgctggcatcatggaagtcggcttggtctattctccagtgatggccatcccaccg
ggccagaaggacttccttctgaccggttactgcacggacaaatgcaccgatagagccctg
ccgtccaacgggatcaaaatcttcgcctctcagctccacactcatctgggtggaaggggg
gtcccccccatcttggtccgggagggtaaagaagccgaggttgtgaatgctgatggccat
tatagcccacactttcaggaaatccgaatgttgaagaaggccgtccatgttctccctggg
gatgtgatggttaccagctgttcgtacaatacagaagacaggaaaaacattaccgtgggc
ggtttcagcatcacggatgaaatgtgtgtaaattacgtgcactattacccacgcacagac
ctggagttgtgcaagagcatggtggatcccgggtacctacaaaaatacttccacatggtg
aacaggttcaacagtgatgacgtctccacctctcccaacacaacggttaccaagcagttc
caggaggtcccatggaattcattcagcgctggggtcttgaagtccttgtacagctttgcc
cctatctccatgcactgcaaccggtcgtccgccgttagattcccaggggaatgggaaaag
cagccgctgccgcagatcaatgaaaagttaccttcacccccagcaacctgtccggccatg
gaccccgcgaagtctaaaggccccacccttgtacggctgctgcagtag

DBGET integrated database retrieval system