KEGG   Xenopus tropicalis (western clawed frog): 100492247Help
Entry
100492247         CDS       T01011                                 

Gene name
dbh
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100492247 (dbh)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100492247 (dbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 615 aa AA seqDB search
MAKRRFCSFSNLRIREVVPVYFTMLAVFMILLVASLQGPSRQQKSSFPYQVPLDPQGSLQ
LYWNVSYSEKVVYFRILIKDLKFGLIFGMSDRGDFEDADMAVLWTNELGSFFGDAWSDQK
GQLHMDSQQDYELLNAQQSQEGLYLLFRRPFATCDPKDYLIEDGTVHLIYALLEKPFSTL
SSIDVSAIKNRGLQRVQLLKPDLPIPRLPADVLNMEVRAPQVLIPAKETTYWCHITELPK
DFTKHHIVMYEPVITKGHEAIVHHIEVFQCASNYYTIPRYDGPCDSKMKPQSLNSCRHVL
AAWAMGAKAFYYPEESGLAFGGPDSSRYLRLEVHYHNPLELKGLRDSSGIRLYYTSTLRR
YDAGIMEVGLVYSPVMAIPPGQKDFLLTGYCTDKCTDRALPSNGIKIFASQLHTHLGGRG
VPPILVREGKEAEVVNADGHYSPHFQEIRMLKKAVHVLPGDVMVTSCSYNTEDRKNITVG
GFSITDEMCVNYVHYYPRTDLELCKSMVDPGYLQKYFHMVNRFNSDDVSTSPNTTVTKQF
QEVPWNSFSAGVLKSLYSFAPISMHCNRSSAVRFPGEWEKQPLPQINEKLPSPPATCPAM
DPAKSKGPTLVRLLQ
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagaaggttctgctccttctccaacctcaggatcagggaggtggtccctgtc
tatttcacaatgttggccgtctttatgattctcctggtggcctcgctacagggcccatcc
cggcagcagaagtcatccttcccttaccaggtaccactggatccccaaggttctctccaa
ctctactggaatgttagttactccgaaaaagtggtctacttccggatcctgattaaagac
ctgaaattcgggctgatttttgggatgtcggacagaggagactttgaagatgccgacatg
gccgtgctctggaccaatgaactgggctctttctttggagatgcctggagtgaccaaaag
gggcaactccacatggattcccaacaagactatgaactgctgaatgcccaacagtctcag
gagggtctctatcttctctttagaagaccatttgccacgtgtgatccaaaggattatcta
atagaggatgggaccgttcatttaatctatgctctgcttgagaagccattctccactctt
tcttctattgatgtctctgccataaaaaatcggggacttcagagagttcaactcctcaag
ccagacctgcccattcccagactcccagcagatgtcctcaacatggaagtcagggccccc
caggttttgattccagccaaagaaaccacctactggtgccatatcacggagcttcctaaa
gactttacgaagcaccacattgtcatgtacgagcctgtgattacaaagggacatgaagcc
atcgtccatcacattgaggtcttccaatgtgcctcgaactactacaccattccccgatac
gatggaccatgtgactccaagatgaaaccccaaagcttgaactcttgtcgccacgtcttg
gctgcctgggcaatgggagctaaggctttttactacccagaagaaagtggtttggccttt
ggtgggcctgattcttctagataccttcggctggaggtccattatcataatcctctggag
ttaaaaggtctcagggactcttctggaattcgactttattacacctcgaccctaagaaga
tacgatgctggcatcatggaagtcggcttggtctattctccagtgatggccatcccaccg
ggccagaaggacttccttctgaccggttactgcacggacaaatgcaccgatagagccctg
ccgtccaacgggatcaaaatcttcgcctctcagctccacactcatctgggtggaaggggg
gtcccccccatcttggtccgggagggtaaagaagccgaggttgtgaatgctgatggccat
tatagcccacactttcaggaaatccgaatgttgaagaaggccgtccatgttctccctggg
gatgtgatggttaccagctgttcgtacaatacagaagacaggaaaaacattaccgtgggc
ggtttcagcatcacggatgaaatgtgtgtaaattacgtgcactattacccacgcacagac
ctggagttgtgcaagagcatggtggatcccgggtacctacaaaaatacttccacatggtg
aacaggttcaacagtgatgacgtctccacctctcccaacacaacggttaccaagcagttc
caggaggtcccatggaattcattcagcgctggggtcttgaagtccttgtacagctttgcc
cctatctccatgcactgcaaccggtcgtccgccgttagattcccaggggaatgggaaaag
cagccgctgccgcagatcaatgaaaagttaccttcacccccagcaacctgtccggccatg
gaccccgcgaagtctaaaggccccacccttgtacggctgctgcagtag

DBGET integrated database retrieval system