KEGG   Xenopus tropicalis (western clawed frog): 100492267Help
Entry
100492267         CDS       T01011                                 

Gene name
rasgrf1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100492267 (rasgrf1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100492267 (rasgrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1240 aa AA seqDB search
MQRLRLNEAHAVYLGQLARKDGTRKGILSKRSSDNSRWQSRCFSLLYNLLFCFESESSGR
PCALYLLEGCSCERGAKGGPDRQYYFIINFNHENQKPLELRTEDAKDCEEWVTAISRASY
KTLVTEHEALMQKYLHLLQIVETEKKVAKQLRQQIEDGEVEVERLKSEIASLLKDNERIQ
STQTAAPNEDVDIKKIKKVQSFLRGWLCRRKWKSIIQDYSRSPHADSMRKRNQVVFSMLE
AEAEYVQQLHILVNNFLRPLRMAASSKKPSITHDDVSSIFLNSETIMFLHQIFYQGLKAR
ISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCE
ERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLEYAKSKLEELSRIMHDEVSET
ENIRKNLAIERMIVEGCEVLLDTSQTFVRQGCLIQVPMSEKSRITRGRLGSLSLRKEGER
QCFLFSKHLLICTRSSGGKLHLTKNGVVSLMDCTLLEENDDDDNRQDGDHLDFKISVEPK
DSAPFVVILLASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVSVPQMIKSDSSLY
CDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTADIVL
EKLIAIYRKPVSAIPARSLELLFASNQNNKLLYGEPPKSPRATRKFSSPPPLSITKSSSP
SRRRKLSLNIPIITGGKALDLAALGCSTNGYQSTCPAPPPYSKTTLDINKLYVSGSFPSK
VGEGEEPPAERDEEPGTQRQNSEVSTRGDSDNEQTDGDEAETDTSPTRSPTTPVSQRGRN
SADFTLFSYNNGIVMTACREHDNSRSNLSAASAFAIATAGANEGTPTKETYRRMSLATAG
FPSDQRNGDKEFVIRRAATNRVLNVLRHWVSKHAQDFETNLQLKTKVICFLEEVIHNPEL
LAQERKAAANIIRTLTQEDPGDSQVTLEEIENMVLDGPMELFESLSALEIAEQLTLLDHL
IFKKIPYEEFFGQGWMKNDKNERTPYIMNTSKHFNLMSNLIATEMRGCTIEKWVAVADIC
RCLHNYNLFWRLHHAVLEITSSLNRSAIYRLKRTWIKVSKQTKTLIDRLQKLVSSEGRFK
NLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQ
TSYKIEHQPKVTQYLLDSSTVLDEEGLYEASLRLEPKLPT
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggctccggttgaatgaggctcacgccgtgtacctggggcagctcgcccggaaa
gacgggacgcgtaaggggatcctgagcaagcggagctcggacaacagccgatggcagagc
cggtgcttctccctcctctacaacctgctcttctgcttcgagagcgagtccagcgggcgt
ccgtgtgcgctttacctgctggagggatgcagctgcgagcggggggccaaagggggcccg
gacagacagtattattttatcatcaacttcaaccacgagaaccagaaacctctggagctg
aggacagaagatgccaaggactgtgaagagtgggtgaccgcaatctcacgagccagctac
aagacattagtgactgaacatgaagctttgatgcaaaagtatttgcatttactgcagatt
gttgagacggagaagaaggtggcaaaacagttgcggcagcagatagaagatggagaggta
gaggtggagcgtcttaaatctgagattgcatcattattgaaagacaatgaacgcatccag
tcaacacaaactgcagccccaaatgaggatgttgacatcaaaaagattaaaaaggtacag
agcttcctgcgtggctggctgtgccgcaggaagtggaagagcattatccaggattactcg
aggtctccccatgcagacagcatgcggaagaggaatcaagttgtgttcagtatgctggaa
gccgaggctgagtatgtgcaacagttacacatactggtcaataatttcctgcggccactt
cgcatggctgccagctccaaaaagccttcaattactcatgatgatgtcagcagcattttc
ctcaacagtgaaaccatcatgtttttgcaccagatattttaccaaggtctgaaggctaga
atatccagctggcccacactggtgctggcggacctgtttgacatccttctgccaatgctg
aacatttatcaggaatttgtgcggaaccatcagtacagtctgcagattctggctcactgc
aaacagaaccgggattttgacaaactgctgaaacaatatgaagccaaaccagactgtgag
gagcggacgctggaaaccttcctcacatatcccatgtttcagattcctcgatacatactc
actctacatgaactgctggctcatacacctcatgaacatgtggagcggaatagtctggaa
tatgctaaatccaaactggaggagctctcacgaattatgcacgatgaagtcagcgaaacc
gagaatatccggaagaatctggcaattgagaggatgatagttgaggggtgcgaagtttta
ctggacaccagtcagacatttgtgcggcaaggctgtctcatccaggtccctatgtcagag
aagagtaggataacaagaggacgccttggttctctgtctctgagaaaggaaggagaacgt
cagtgctttttattttccaaacaccttctgatctgcacacggagctcagggggcaagtta
catctcaccaagaacggagtggtctcgctgatggactgcactttactagaagaaaatgat
gatgatgacaacagacaagatggggatcacttagactttaaaatctctgtggaacccaaa
gattctgcaccatttgttgtcattcttcttgcatcatccagacaggagaaagcagcctgg
acaagtgacataagccagtgtgtggacaacatccgctgcaatggccttatgatgaatgca
tttgaggagaattccaaggtttctgttcctcagatgatcaagtctgacagcagtttgtac
tgtgatgatgtggacatacgctttagcaagaccatgaattcatgcaaggttctccagatt
cgctatgcaagtgtcgaacgcttactggaacgtctcacagacttgcgcttcctgagcatc
gatttcctcaacacgttcttgcactcctaccgggttttcaccactgctgacattgtactg
gaaaagcttattgctatttacaggaagccagtcagtgctatccctgccaggtccctggag
ctcctgtttgctagtaatcagaataacaaacttctatatggggagcccccaaaatctccc
agagccactcgcaagttttcatctccaccacctttatccattacaaagtcctcatcacca
agccgccgacgcaaactctccctcaacattcctataataacgggaggaaaagcacttgac
cttgctgctcttgggtgttccaccaatggataccaaagtacttgtcctgcccctccacca
tacagcaagactactttagacatcaacaaactctatgtgtctgggagctttcccagtaag
gtgggggagggagaagaacctcctgcagagagggatgaagaaccagggactcagaggcag
aactctgaagtttccacccgtggagattcggacaatgagcaaacggatggtgacgaggct
gaaacagatacttctcctacacgttctcccaccaccccagtatctcagcgaggccgtaac
tctgcagatttcacactcttttcatataataatggcattgtgatgaccgcctgtcgggaa
catgataacagccgaagcaacctatcagcagcttctgcctttgctatagcaacagctgga
gccaatgagggaacaccaacaaaagagacctacagacgcatgtctttagccactgcaggg
ttcccctcagatcaaagaaacggagacaaagaatttgtaatcagaagagcagcaacgaac
cgagtgctgaatgtactgagacactgggtgtccaaacatgcacaggattttgagaccaat
ctgcagctaaagacaaaggtgatttgtttcctggaggaggttatccacaaccctgagttg
ctggctcaagagcggaaggcagcagccaatatcattcgcacattgacccaggaggatccc
ggagacagtcaggttactttggaagaaattgagaatatggtattggatggtccaatggaa
ctctttgaatccctgtctgcattggagattgcagagcaactcacattattggatcacctc
atcttcaaaaaaatcccttatgaagaattctttggtcaaggttggatgaaaaatgacaag
aatgaacggacaccttacataatgaacactagcaagcacttcaaccttatgagtaatttg
attgccactgagatgcgtggatgtaccatagaaaagtgggttgccgtagctgatatttgt
cgctgtctccataattacaatctgttttggagattacatcatgctgttttggagattaca
tcatccctaaaccgcagtgcaatataccgtctcaagaggacttggatcaaggtttccaag
cagacaaagacgttaattgaccggttacaaaagctggtgtcttcagaaggacgattcaag
aatcttagggaagctctaaagaattgtgacccaccatgtgtcccttatctgggcatgtac
ctaacagatctggcttttatagaggaagggaccccaaattacacagaagacggactggtc
aacttctctaagatgaggatgatttcacacattattcgagagattcggcagtttcagcag
acttcatacaagattgaacatcagcccaaggtgacacagtatctcctggattcttcaaca
gtgctagatgaagaaggtctatatgaagcttctctccgactggagcccaaactccccacc
tga

DBGET integrated database retrieval system